KEGG   Citrobacter rodentium: ROD_04091
Entry
ROD_04091         CDS       T01145                                 
Symbol
uhpA
Name
(GenBank) two-component system response regulator protein
  KO
K20264  two-component system, NarL family, response regulator FusR
Organism
cro  Citrobacter rodentium
Pathway
cro02020  Two-component system
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_04091 (uhpA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_04091 (uhpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cro02022]
    ROD_04091 (uhpA)
Two-component system [BR:cro02022]
 NarL family
  FusK-FusR (virulence regulation)
   ROD_04091 (uhpA)
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_38 Terminase_5
Other DBs
NCBI-ProteinID: CBG87191
UniProt: D2TKV0
LinkDB
Position
complement(460301..460930)
AA seq 209 aa
MIRVVLVDDHVVVRSGFAQLLSLEEDLEVAGQFSRAADAWPALLRDDVSVAVMDIAMPDE
NGLSLLKRLRAQKPQFRAIILSIYDSPTFVQSALTAGASGYLTKRCGPEELVQAVRSVGL
GGHYLCADALRALRGGEQLPPELEALTPREREVFNLLVKGDSVKEIAFKLDLSHKTVHVY
RANVLGKLNCHSTIELVHFALDHKLLVGH
NT seq 630 nt   +upstreamnt  +downstreamnt
atgatacgtgtggtgctggtggacgaccatgtggtggtgcgttccggctttgcgcaatta
ctcagtctcgaagaggaccttgaggtcgcgggccagttcagccgcgcggcggacgcgtgg
cctgcgctgttgcgcgacgacgttagcgtggcggtgatggatatcgccatgccggatgag
aacggcctgagcctgctgaagcgcctgcgggcgcagaagccgcagtttcgcgccattatt
ctcagcatctatgattcgcccacctttgtacaaagcgcgctgaccgccggggccagcggc
tacctgaccaagcgctgcgggccggaggagctggtgcaggcggtacgctccgtcggcctg
gggggacattatctctgcgccgacgcgctgcgggcgttgcgtggcggagagcaactgccg
ccggagctggaagcgcttactccgcgagagcgtgaagtgtttaatctgctggtcaaaggc
gacagcgttaaggagatcgcctttaagctcgacctcagccataaaacggtccatgtgtat
cgcgccaacgtgcttggcaaactgaactgccacagcaccatcgagctggtgcatttcgcc
ctcgaccataagctgctggtggggcattaa

DBGET integrated database retrieval system