KEGG   Citrobacter rodentium: ROD_04551
Entry
ROD_04551         CDS       T01145                                 
Name
(GenBank) putative preprotein translocase subunit
  KO
K03210  preprotein translocase subunit YajC
Organism
cro  Citrobacter rodentium
Pathway
cro02024  Quorum sensing
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_04551
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_04551
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_04551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_04551
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_04551
SSDB
Motif
Pfam: YajC Orf78 MreC PIRT
Other DBs
NCBI-ProteinID: CBG87234
UniProt: D2TKZ3
LinkDB
Position
509900..510232
AA seq 110 aa
MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGD
EVLTNGGLVGRVTKVAETGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL
NT seq 333 nt   +upstreamnt  +downstreamnt
atgagcttttttatttctgatgcggtagcggcaacaggtgctccggcgcagggcagcccg
atgtctctgattctgatgctggtggtctttggtctgattttctatttcatgatcctgcgt
ccacagcagaagcgtaccaaagagcacaaaaagctgatggattctatcgcgaaaggtgat
gaagtcctgacgaatggcggtctggtgggtcgcgtgacgaaagttgcggaaaccggctac
atcgctatcgccctgaatgacaccacggaagtggtcatcaaacgtgacttcgtagctgcc
gttctgccgaaaggcaccatgaaggcgctgtaa

DBGET integrated database retrieval system