KEGG   Citrobacter rodentium: ROD_04561
Entry
ROD_04561         CDS       T01145                                 
Symbol
secD
Name
(GenBank) protein-export protein
  KO
K03072  preprotein translocase subunit SecD
Organism
cro  Citrobacter rodentium
Pathway
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_04561 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_04561 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_04561 (secD)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_04561 (secD)
SSDB
Motif
Pfam: SecD-TM1 SecD_SecF MMPL Sec_GG
Other DBs
NCBI-ProteinID: CBG87235
UniProt: D2TKZ4
LinkDB
Position
510260..512107
AA seq 615 aa
MLNRYPLWKYIMLIVVIIVGLLYALPNLYGEDPAVQITGARGVAASEQTLIQVQNTLQQE
KITAKSVALEEGAILARFDTTDTQLRAREALVGVLGDKYVVALNLAPATPRWLAAIKAEP
MKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGIPYTTVRKEDNYGLSINF
RDASARDEAIAYLSKRHQDLVISSQGSNALRAVMTDARLSEAREYAVQQNINILRNRVNQ
LGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQAAAASGRVPG
DSEVKQMREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGNIMSNFTKDN
IGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQSRLGNSFRITGINNPNEARQL
SLLLRAGALIAPIQIVEERTIGPTLGMQNIKQGLEACLAGLAVSILFMVLFYKKFGLIAT
SALIANLVLIVGVMSLLPGATLSMPGIAGIVLTLAVAVDANVLINERIKEELSNGRSIQQ
AINEGYAGAFSSIFDANITTLIKVIILYAVGTGAIKGFAITTGIGVATSMFTAIVGTRAI
VNLLYGGKRVKKLSI
NT seq 1848 nt   +upstreamnt  +downstreamnt
gtgttaaaccgttatcctttgtggaagtatatcatgctgatcgtcgtgattatcgtcggt
ctgctgtatgcgcttcccaacctgtatggtgaggatccggccgttcaaatcactggcgcg
cgcggcgtcgccgccagtgagcaaacgctgatccaggtccagaatacgttacaacaagaa
aaaattaccgcgaagtctgtggcactggaagagggcgctatccttgcgcgcttcgacacc
accgacactcaactgcgcgcacgtgaagcgctggtgggcgtgctgggtgataaatacgtc
gtggcgcttaaccttgctccggcaaccccgcgctggctggccgccatcaaagcagagccg
atgaaactcggccttgatctgcgtggcggcgttcacttcctgatggaagtggatatggac
accgctctgggcaaactgcaggaacaaaatattgacagcctgcgcagcgatctgcgtgaa
aaaggcattccgtataccaccgtccggaaagaggacaactacgggctgagcattaacttc
cgtgacgccagcgcgcgtgacgaagcgattgcttatctcagcaagcgtcatcaggatctg
gtgatctccagccagggcagcaatgcgctgcgcgcggtgatgaccgatgcccgtctgagc
gaagcgcgtgagtatgcggttcagcagaacatcaacatcctgcgcaaccgtgttaaccag
ctgggcgtcgccgaaccggtggttcagcgtcagggcgccgaccgtatcgtggtcgaactg
ccgggcatccaggacaccgcgcgcgccaaagagattctcggcgcgacggcaacgctggag
tttcgtctggtcaacaccaacgtagatcaggccgctgcggcatctggtcgcgtaccgggc
gactccgaagtgaagcaaatgcgtgaaggccagccggtggtgctgtacaagcgcgttatt
ctgaccggcgaccatatcaccgactccacgtcgagccaggatgaatacaaccagccgcag
gtaaacatctcgctggacagcgcgggcggcaatatcatgtctaacttcaccaaagacaat
atcggcaagccgatggcgacgctgttcgtggagtataaagacagcggtaagaaagacgcc
aacggtcgcgcggtgctggtgaaacaggaagaggtgattaacatcgccaacatccagtct
cgcctcggcaacagcttccgtattaccggcatcaacaacccgaacgaagcgcgtcagctc
tctctgctgctgcgcgcgggcgccctgattgcgccgattcagattgttgaagaacgcact
atcggtccaaccctcgggatgcagaacatcaagcagggcctggaagcgtgtctggccggt
ctggcggtatctatcctgttcatggtgctgttctataagaagtttggtctgattgcgacc
agcgcgctgatcgctaacctggtgctgattgtcggcgtgatgtcgctgctgccgggggcc
acgctgagtatgccggggattgcggggatagtcttaacccttgccgtcgccgtcgatgcg
aacgtactgatcaacgaacgtattaaagaagagttgagcaacgggcgttcgatccagcag
gcgatcaacgaggggtatgcgggcgcgttcagttccattttcgatgcgaacattacgacg
ctgattaaggtcattatcctgtacgcggtcggcaccggggcaattaaagggttcgcgatt
actaccggtatcggtgtggcgacgtcgatgtttaccgcgatcgtcggtacacgtgccatc
gtaaacctgctgtatggcggcaagcgcgtcaagaagctgtcaatctga

KEGG   Citrobacter rodentium: ROD_04571
Entry
ROD_04571         CDS       T01145                                 
Symbol
secF
Name
(GenBank) protein-export protein
  KO
K03074  preprotein translocase subunit SecF
Organism
cro  Citrobacter rodentium
Pathway
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_04571 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_04571 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_04571 (secF)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_04571 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG ACR_tran PIG-F T4SS_pilin
Other DBs
NCBI-ProteinID: CBG87236
UniProt: D2TKZ5
LinkDB
Position
512118..513089
AA seq 323 aa
MAQEYTVEQLNHGRKVWDFMRWDYWAFGISGLLLVASIVVMGVRGFNWGLDFTGGTVIEI
TLEKPAEMDVMREALEKAGFVDPLLQNFGSSHDIMVRMPPTEGANGGQVLGSKVLSVINE
STNQNAAVKRIEFVGPSVGADLAQTGAMALLAALISILVYVGFRFEWRLAAGVVIALAHD
VIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIRENFRKIRRGTPYEIFNVS
LTQTLHRTLITSGTTLMVILMLFLFGGPVLEGFSLTMLIGVSIGTASSIYVASALALKLG
MKREHMLQQKVEKEGADQPSILP
NT seq 972 nt   +upstreamnt  +downstreamnt
gtggcacaggaatatactgttgaacaattgaaccacggccgtaaagtctgggactttatg
cgctgggattactgggctttcggcatctctggccttctgctggtggcatccatcgtggtg
atgggcgtacgcggctttaactgggggctcgattttaccggtggtacggttatcgaaatt
acgctggaaaaaccagcggagatggacgtgatgcgcgaggcgctggagaaagcgggcttt
gttgatccgcttttacagaacttcggcagcagccacgacatcatggtgcgtatgccgccg
accgaaggggcaaacggcgggcaggtgctgggcagcaaagtgctgagtgtgattaacgaa
tccaccaaccagaacgcggcggtgaagcgaattgaattcgttggcccgagcgtgggcgcc
gatctggcgcaaaccggcgcgatggcgctgctggcggcgctgatctccattctcgtttac
gtcggtttccgcttcgagtggcgactggcggccggggtggttatcgcgctggcgcacgac
gtgatcatcacgcttggtattctgtcgctgttccatatcgagattgacctgactatcgtg
gcatcgctgatgtccgtaatcggctactcgctgaacgacagtatcgtggtttcggaccgt
attcgtgaaaacttccgcaagatccgtcgcggtacgccttacgaaatctttaacgtgtcg
ttgacccagacgctgcaccgtaccttgatcacttccggtacgacgttgatggtgattctg
atgctgttcctgtttggcggcccggtgctggaaggcttctcgctgaccatgctgatcggc
gtctccatcggtactgcctcttccatctacgtagcatcggcgctggcgctgaagctgggc
atgaagcgtgagcacatgctgcaacagaaggttgagaaagaaggggcggatcagccgtca
attctgccgtaa

DBGET integrated database retrieval system