KEGG   Citrobacter rodentium: ROD_05171
Entry
ROD_05171         CDS       T01145                                 
Symbol
acrB
Name
(GenBank) acriflavin resistance protein B
  KO
K18138  multidrug efflux pump
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_05171 (acrB)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_05171 (acrB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_05171 (acrB)
   01504 Antimicrobial resistance genes [BR:cro01504]
    ROD_05171 (acrB)
Transporters [BR:cro02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ROD_05171 (acrB)
Antimicrobial resistance genes [BR:cro01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    ROD_05171 (acrB)
SSDB
Motif
Pfam: ACR_tran MMPL SecD_SecF
Other DBs
NCBI-ProteinID: CBG87297
UniProt: D2TLT8
LinkDB
Position
complement(574651..577800)
AA seq 1049 aa
MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTIAATYPGADAKTVQDT
VTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQ
EVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMKDTISRTSGVGDVQLFGS
QYAMRIWMDPTALNNYQLTPVDVINAIKAQNAQVAAGQLGGTPPVKGQQLNASIIAQTRL
TSTEEFGKILLKVNQDGSQVRLRDVAKIELGGENYDVIAKFNGQPASGLGIKLATGANAL
DTASAIRAELVKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILVFLVMYLFLQ
NFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVM
SEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFIPMAFFGGSTGAIYRQFSITIVSAMAL
SVLVALILTPALCATMLKPVAKGDHGEGKKGFFGWFNRMFDKSTHHYTDSVGNILRSTGR
YLLLYLIIVVGMAFLFVRLPSSFLPDEDQGVFLSMAQLPAGATQERTQKVLDEMTDYFLT
KEKANVESVFAVNGFGFAGRGQNTGIAFVSLKDWGERPGDENKVEAITQRASAAFSQIKD
AMVFAFNLPAIVELGTATGFDFQLIDQAGLGHEKLTQARNQLFGEVAKHPDLLVGVRPNG
LEDTPQFKIDIDQEKAQALGVSISDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSQAKYR
MLPEDIGNWYVRGSNGQMVPFSAFSTSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEA
MAMMEELASKLPSGIGYDWTGMSYQERLSGNQAPALYAISLIVVFLCLAALYESWSIPFS
VMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGKGL
IEATLEAVRMRLRPILMTSLAFILGVMPLVISSGAGSGAQNAVGTGVMGGMVTATVLAIF
FVPVFFVVVRRRFSRKSEDVEHSHAVEHR
NT seq 3150 nt   +upstreamnt  +downstreamnt
atgcctaatttctttatcgatcgccccatattcgcatgggtgatcgccattatcatcatg
ttggcaggggggcttgcgatcctcaaactgccggtcgcgcaatacccaacgattgcgccg
cccgcagtgacgatcgccgcaacctaccctggcgctgatgccaaaaccgtgcaggacacg
gtcacgcaggttatcgaacagaatatgaacggtatcgataacctgatgtacatgtcctca
aacagtgactccacgggtacggtgcagatcaccctgacgtttgaatccggcaccgatgcg
gatatcgcccaggtgcaggtgcagaacaaactgcagctggcgatgccgctgctgccgcag
gaagttcagcaacagggcgtgagcgttgagaaatcatccagtagcttcctgatggtggtt
ggcgtcattaataccgacggcaccatgacccaggaagatatttccgactacgttgccgcc
aacatgaaggacaccatcagccgtacctccggcgttggcgacgtccagctgtttggttcg
cagtacgcgatgcgtatctggatggatccgacggcgcttaacaactatcagctgaccccg
gtcgatgtcattaacgcgattaaagcgcagaacgcccaggtggcggcaggccagttgggc
ggtacgccgccggtgaaaggccagcagcttaacgcctcgatcattgcccagacgcgtctg
acctccaccgaggagttcggcaaaattctgctgaaggtgaatcaggatggttcgcaggtt
cgcctgcgcgacgttgcaaaaatcgagctgggcggcgagaactacgacgttattgcgaag
tttaacggccagccagcctccggtttaggtatcaaactggcgaccggcgccaacgcgctg
gataccgcgtcggctatccgcgccgaactggtgaagatggagccgttcttcccgtcgggt
ctgaaaatcgtttatccgtatgacaccacgcctttcgtgaaaatctccattcacgaagtg
gtgaaaacgctggtggaagcgatcatcctcgtgttcctggtgatgtatctgttcctgcaa
aacttccgcgcgacgctgatcccgaccatcgccgttccggtggtactgttgggaaccttt
gcggtacttgcggcgttcggcttctcgataaacaccctgacgatgttcgggatggtgctc
gccatcggcctgctggtggatgacgccatcgtggtggttgagaacgtcgagcgcgtgatg
tctgaagaaggactgccgccgaaggaggcgacgcggaaatcgatgggtcagattcagggc
gcgctggtgggtatcgcgatggtgctgtcagccgtatttatcccgatggccttctttggc
ggctcaaccggggcgatttaccgtcagttctccatcaccatcgtctccgcgatggcgctg
tcggtactggtcgcgttgatcctgacgccagcgctgtgcgccaccatgctcaagccggtt
gccaaaggcgatcatggcgaaggcaaaaaaggtttctttggctggtttaaccgcatgttc
gataagagcacgcatcactacaccgacagcgtaggcaacattctgcgcagtaccggtcgt
tacctgctgctttatctgatcatcgtggtcggcatggcctttctgttcgttcgtctgcca
agctccttcctgccggatgaagaccagggggtattcctgagcatggcccagttacctgcc
ggtgcgactcaggaacggacgcagaaagttctcgatgagatgaccgactatttcctgacc
aaagaaaaagccaacgttgagtcggtgtttgcggttaacggcttcggttttgcgggtcgc
gggcagaacaccggtatcgccttcgtctccctgaaagactggggcgagcgtccgggcgat
gagaacaaagttgaagcgattacccaacgcgcttcggcggccttctcgcagattaaagat
gcgatggtcttcgcctttaacctgccagcgatcgttgagctgggtacggcgaccggtttc
gacttccagctgattgaccaggcgggtctggggcatgaaaaactcacccaggcgcgtaac
cagctgttcggcgaagtggcgaaacatccggacctgctggtcggggtacgtccaaacggt
ctggaagatacgccgcagttcaagatcgacatcgatcaggaaaaagcgcaggcgctgggc
gtttctatcagcgatatcaataccactctcggcgcagcgtggggcggaagctacgtgaac
gactttatcgaccgcggtcgtgtgaaaaaagtttacgtcatgtcccaggccaaataccgc
atgttgccggaagatatcggtaactggtacgtccgcggcagcaatggtcagatggtgccg
ttctcggccttctctacatcgcgctgggagtacggctcaccgcgtctggaacgttataac
ggtctgccttcaatggaaattttaggccaggcggcgccaggtaagagtaccggtgaagcg
atggcgatgatggaagaactggccagtaagctgccatccggcatcggctatgactggacg
gggatgtcctatcaggaacggctgtcgggcaaccaggcccctgccctgtatgccatctcg
ctgatcgtcgtcttcctctgtctggcggcgctgtatgaaagctggtcgattccgttctcg
gttatgctggtcgttccgctgggggttatcggcgcgctgttggcggcaaccttccgcgga
ctgaccaacgacgtctacttccaggtgggcctgctcacaaccattggcctgtcggcgaag
aacgcgatactgatcgtcgaattcgccaaggacctgatggataaagaaggcaaagggctg
atagaagcgacgctggaagcggtgcgtatgcgcttacgtccgatcctgatgacctcgctg
gcgttcattctgggcgttatgccgctggttatcagctccggcgcaggctccggcgcgcag
aacgctgttggtacgggcgttatgggcgggatggtcaccgcgaccgtgctggctatcttc
ttcgttccggtcttctttgtggtggtacgccgccgcttcagccggaagagtgaagacgtt
gagcacagccatgccgtagagcatcgctga

DBGET integrated database retrieval system