KEGG   Citrobacter rodentium: ROD_05181
Entry
ROD_05181         CDS       T01145                                 
Symbol
acrA
Name
(GenBank) acriflavin resistance protein A
  KO
K03585  membrane fusion protein, multidrug efflux system
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_05181 (acrA)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_05181 (acrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cro03036]
    ROD_05181 (acrA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_05181 (acrA)
   01504 Antimicrobial resistance genes [BR:cro01504]
    ROD_05181 (acrA)
Chromosome and associated proteins [BR:cro03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ROD_05181 (acrA)
Transporters [BR:cro02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   ROD_05181 (acrA)
Antimicrobial resistance genes [BR:cro01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    ROD_05181 (acrA)
SSDB
Motif
Pfam: HlyD_D23 CusB_dom_1 HlyD_3 Biotin_lipoyl_2 OEP EAD11 tRNA_anti-codon
Other DBs
NCBI-ProteinID: CBG87298
UniProt: D2TLT9
LinkDB
Position
complement(577823..579016)
AA seq 397 aa
MNKNRGLTPLAIVLMLSGSLALTGCDDKQAQQGGQQMPEVGVVTLKTEPLQITTELPGRT
SAFRIAEVRPQVSGIILKRNFEEGSDIEAGVSLYQIDPATYQASYESAKGDLAKAQAAAS
LAQVTVNRYKKLIGTQYISKQDYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPI
SGRIGKSAVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENG
KAKVELVTSDGIKFPQSGTLEFSDVTVDQTTGSITLRAVFPNPDHTLLPGMFVRARLEEG
TNPNALLVPQQGVTRTPRGDATALVVGADNKVETRQIVATQAIGDKWLVTDGLKPGDRVV
VTGLQKVRPGVQVKAQEITADNKQQAADGNQPEQSKS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgaacaaaaacagagggttaacgcctctggcgatcgttctgatgctctcaggcagctta
gcgctaacaggatgtgacgacaaacaggcccaacaaggggggcagcagatgccggaagtt
ggggtcgtgacgctcaaaaccgaacctctacagatcaccactgaactcccgggtcgcacc
agcgctttccgcattgcggaagttcgccctcaggtaagcggtattatcctgaagcgtaat
ttcgaagaaggtagcgatatcgaagcaggtgtatctctctatcagattgatcctgcgact
tatcaggcgtcttacgaaagtgcgaaaggcgatctggcgaaggcccaggccgcagccagc
cttgcccaggtcacggtgaaccgttataagaaactgatcggcacgcagtacatcagtaag
caggattacgaccaggcgctggcggatgcgcagcaggcaaacgccgccgtgacggccgcg
aaagccgcagtcgaaaccgcgcgtatcaacctggcttataccaaagtgacctcgccgatt
agcggacgcattggtaaatcggccgtcaccgagggcgcgctggtgcaaaacggtcaggct
accgcgctggcgaccgtccagcagcttgatcccatctatgttgatgtgacccagtcaagc
aatgacttcctgcgcctgaagcaagagctggctaacggaacgctgaaacaggaaaacggc
aaggcgaaagtcgagctggtgaccagcgacggcattaaattcccgcagtcaggcacgctt
gagttctcagacgttaccgtcgatcagaccaccgggtctatcaccctacgcgccgtcttc
cctaaccctgaccacacgctgctgccgggcatgttcgtccgcgcccgtctggaggaaggg
actaaccccaacgcgctactggtgccgcaacaaggggtgacccgtacgccgcgtggcgac
gcaaccgcgctggttgtcggtgcggataacaaagtggaaacccgtcaaatcgtcgccact
caggcgattggcgacaaatggctggtcaccgacgggctgaagccgggcgatcgcgttgtt
gtcaccggtctgcaaaaagtgcgtcctggcgtacaggtgaaggcgcaagagattaccgcg
gataacaaacagcaagccgccgacggtaaccagcctgagcagtctaagtcttaa

DBGET integrated database retrieval system