KEGG   Citrobacter rodentium: ROD_06371
Entry
ROD_06371         CDS       T01145                                 
Symbol
pagP
Name
(GenBank) putative antimicrobial peptide resistance and lipid A acylation protein
  KO
K12973  lipid IVA palmitoyltransferase [EC:2.3.1.251]
Organism
cro  Citrobacter rodentium
Pathway
cro00540  Lipopolysaccharide biosynthesis
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ROD_06371 (pagP)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_06371 (pagP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cro01005]
    ROD_06371 (pagP)
Enzymes [BR:cro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.251  lipid IVA palmitoyltransferase
     ROD_06371 (pagP)
Lipopolysaccharide biosynthesis proteins [BR:cro01005]
 Lipid A
  ROD_06371 (pagP)
SSDB
Motif
Pfam: PagP
Other DBs
NCBI-ProteinID: CBG87412
UniProt: D2TMR7
LinkDB
Position
700214..700792
AA seq 192 aa
MVVNVVIVAKKYFLFITLLIIQVSLPAHAGTDEKGWFNTFTDNVAETWREPEHYDLYIPA
ITWHARFAYDKRKTDRYNERPWGGGFGQSRWDEKGNWHGLYVMAFKDSWNKWEPIGGYGW
ESTWRPLPDDNFHLGLGFTAGVTARDNWKYIPVPVLLPLASIGYGPATFQMTYIPGTYNN
GNVYFAWMRFQF
NT seq 579 nt   +upstreamnt  +downstreamnt
atggttgtaaacgttgtgatagttgctaaaaaatattttttgtttattacgttgcttatt
attcaggtgagcctgccagcgcatgccgggacggatgagaaaggatggtttaataccttt
acggataatgtcgccgaaacgtggcgcgaacctgagcattacgatttatatattccggcc
attacctggcatgcccgttttgcttacgacaaaaggaaaaccgatcgctataacgagcgg
ccctggggcggtggttttggtcagtcgcgctgggatgaaaaagggaactggcacgggctg
tacgtgatggcctttaaagactcatggaataagtgggagcctatcggcggttacggatgg
gaaagcacctggcgaccgctgccggatgacaacttccatctggggttagggtttaccgca
ggcgtgacggcgcgcgataactggaaatacatcccggtccccgtcctgctgccgctggcc
tccattggctacggaccggcgactttccagatgacctacatccccggtacttacaataac
ggtaacgtctattttgcatggatgcgtttccagttctga

DBGET integrated database retrieval system