KEGG   Citrobacter rodentium: ROD_06501
Entry
ROD_06501         CDS       T01145                                 
Symbol
dacA
Name
(GenBank) penicillin-binding protein 5 (D-alanyl-D-alanine carboxypeptidase)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cro  Citrobacter rodentium
Pathway
cro00550  Peptidoglycan biosynthesis
cro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROD_06501 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cro01002]
    ROD_06501 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_06501 (dacA)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ROD_06501 (dacA)
Peptidases and inhibitors [BR:cro01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ROD_06501 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ROD_06501 (dacA)
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Other DBs
NCBI-ProteinID: CBG87425
UniProt: D2TNF6
LinkDB
Position
complement(710590..711801)
AA seq 403 aa
MKTTFSARFLQRMALTTALCTAALSGAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADTRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVTALGLKNTHFQTVH
GLDADGQYSSARDMALIGQALIRDVPNEYSVYKEKEFTFNGIRQLNRNGLLWDNSLNVDG
IKTGHTAKAGYNLVASATEGQMRLISAVMGGRTYKGRETESKKLLTWGFRFFETVNPLKA
GKEFASEPAWFGDTDRASLGVDKDVYLTIPRGRMKDLKASYLLNTTELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEIPEGNFFGKIVDYIKLMFHHWFG
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaagaccactttttccgctcgtttcctgcagcgcatggcgctcaccacggctctttgc
acagccgctctctcaggcgcgcatgccgatgacctgaacattaaaaccatgatcccgggt
gttccgcagatcgacgcggaatcttacatccttatcgattacaactccggtaaagtgctg
gctgaacagaacgccgacacccgtcgcgacccggccagcctgaccaagatgatgaccagc
tatgttatcggccaggcgatgaaagcgggtaagtttaaagaaaccgatctggtgacgatt
ggcaacgatgcgtgggcgacaggtaatccggtatttaaaggctcttcgctgatgttcctc
aagccagggatgcaggtgcccgtctcgcagctgattcgcggcattaacctgcaatccggt
aatgacgcctgcgtggcgatggccgatttcgccgccggcagccaggatgcgtttgtcggg
ctgatgaacagctacgttaccgcgctggggctgaaaaacacgcacttccagacggttcac
ggtcttgacgccgacggccagtacagctccgctcgcgacatggcgttgattggtcaggcg
ctgatccgcgacgtccctaatgaatactcggtctataaagaaaaagagttcacctttaac
ggcatccgtcagctgaaccgtaacggtttgctgtgggacaacagcctgaacgttgacggc
atcaaaaccggacatactgcaaaagctggctacaacctggtggcttccgcaaccgaaggt
cagatgcgtttgatctccgcggtcatgggcggtcgcacctataaggggcgcgaaaccgaa
agtaaaaagctgctgacctggggcttccgcttttttgaaaccgttaatccgctgaaagcc
gggaaagagtttgcctccgaaccggcatggtttggcgataccgatcgcgcctctttaggc
gtcgataaggatgtttatctgaccattccgcgtggccggatgaaagatctgaaagccagc
tacctcctcaataccaccgagctgcatgcgccgctgcagaaaaatcaggtggtgggcacc
attaacttccagcttgacggtaaaaccattgagcagcgtccgctggtcgttctgcaggag
atcccggaaggtaacttcttcggcaaaatcgttgattacattaagctaatgttccatcac
tggtttggctaa

KEGG   Citrobacter rodentium: ROD_08451
Entry
ROD_08451         CDS       T01145                                 
Symbol
dacC
Name
(GenBank) penicillin-binding protein 6 (D-alanyl-D-alanine carboxypeptidase)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cro  Citrobacter rodentium
Pathway
cro00550  Peptidoglycan biosynthesis
cro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROD_08451 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cro01002]
    ROD_08451 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_08451 (dacC)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ROD_08451 (dacC)
Peptidases and inhibitors [BR:cro01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ROD_08451 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ROD_08451 (dacC)
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Other DBs
NCBI-ProteinID: CBG87622
UniProt: D2TQF6
LinkDB
Position
933662..934864
AA seq 400 aa
MTHFSTSLRNIAAGSALLFLFAPAVMAAEQTIAAPAVEARAWILMDYASGKVLAEGNADE
KLDPASLTKIMTSYVVGQALKADKIKLTDMVTIGKDAWATGNPALRGSSVMFLKPGDRVA
VADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFRTVHGLDAPGQ
YSTARDMALLGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNRLLWSSNINVDGMKTGTTA
GAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFYETVTPIKPDATFVTQ
RVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASFTLSEPQLTAPLKKGQVVGTIDFQLNG
KSIEQRPLMVMENVEEGGFFSRMWDFVMLKFHQWFGGWFS
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgacgcatttctctacttcccttcgtaatatcgcagcgggttcagcactgttatttctt
ttcgcgccggcggtcatggcggcggagcaaaccatcgccgcgccggcggtggaggcgcgc
gcatggattttaatggattacgccagcggtaaagtgctggcggaaggtaacgctgatgag
aagctggacccggccagtctgacgaaaatcatgaccagctacgttgtggggcaggcgctg
aaagcggataagattaagctgaccgacatggtaaccatcggtaaagatgcctgggcgacc
ggcaatccggcgctgcgcggttcgtcggtcatgttccttaagcccggcgatcgggtggcg
gttgccgatctgaacaaaggggtaatcattcagtccggtaacgatgcctgtatcgcgctg
gccgactacgttgccggaagccaggagtcctttattggcctgatgaacggctacgcgaaa
aagctggggctgaccaacaccaccttccgtacggttcacggccttgatgcccccggtcag
tacagcaccgcgcgcgatatggcgctgctcggcaaggcgctgattcatgacgtgccggaa
gagtatgccatccataaagaaaaagagtttaccttcaacaagatccgtcagcctaaccgt
aaccgactgctgtggagttcgaatatcaacgtcgacggcatgaaaaccggcaccacggcg
ggggcgggctataacctggtcgcctcggccacgcagggcgatatgcgtctgatatccgtg
gtgctgggggctaaaaccgatcgcattcgctttaacgaatcggaaaaactgctcacctgg
ggcttccgcttctatgaaaccgttacgccgatcaaaccggacgccacctttgtcacccag
cgcgtctggttcggcgacaagagcgaagtgaatctgggcgcgggcgaagccggttcagtg
accattcctcgcggccagttgaaaaacctgaaggccagcttcacgctgagcgaaccgcag
ctgaccgcgccgctgaaaaaaggccaggtcgtcggcaccattgacttccagcttaacggc
aaatcgattgagcaacgtccgctgatggtaatggaaaacgtcgaagagggcggctttttc
agccggatgtgggatttcgtgatgttgaaattccatcagtggttcggcggctggttctct
taa

KEGG   Citrobacter rodentium: ROD_21491
Entry
ROD_21491         CDS       T01145                                 
Symbol
dacD
Name
(GenBank) penicillin-binding protein 6B
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cro  Citrobacter rodentium
Pathway
cro00550  Peptidoglycan biosynthesis
cro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROD_21491 (dacD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cro01002]
    ROD_21491 (dacD)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_21491 (dacD)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ROD_21491 (dacD)
Peptidases and inhibitors [BR:cro01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ROD_21491 (dacD)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ROD_21491 (dacD)
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Other DBs
NCBI-ProteinID: CBG88897
UniProt: D2TPS9
LinkDB
Position
complement(2243961..2245133)
AA seq 390 aa
MLLKRRLFIAASLLSLHLSSALAADSVDFAPQPPAIEAGSWVLMDYTTGQILTAGNEHQQ
RNPASLTKLMTGYVVDRAIDSHRISPDDIVTVGRDAWAKDNPVFVGSSLMFLKQGDRVSV
RDLSRGLIVDSGNDACVALADYVAGGQPQFVAMMNNYVKKLHLQDTHFETVHGLDAPGQH
SSAYDLAVLSRAIIHGEPEFYHMYSEKSLTWNGITQYNRNGLLWDKSLNVDGLKTGHTSG
AGFNLIASAVDGQRRLIAVIMGAQSPKGREEQARKLLHWGQQNFDTVQILRNGKQVGTER
IWYGDKEKIALGTEQDFWMALPKTEIPHIKAKYVLDTKALEAPIAAHRRVGEIELYDRDK
LVAHWPLVTLEAVGKGGMFSRLSDYFHHKA
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgctgttgaaacgccgcctgtttatcgccgcttctttactctctttgcacctttcttcc
gcgctggctgccgatagcgttgacttcgcgcctcagccgccagcgatagaagcaggatcg
tgggtgctgatggactacaccaccgggcaaattctcaccgccggaaacgaacatcagcag
cgtaatcccgcaagtctgacaaagctgatgacgggctacgttgtcgatcgcgccatcgac
agccatcgcatttctcctgacgacatcgttacggtagggcgcgacgcctgggcaaaagac
aatccggtttttgtcggctcctcgctgatgtttctcaaacagggcgatcgcgtttcggta
cgtgatttaagccgcgggctgattgtcgattcgggtaatgacgcctgcgtcgcgctggcg
gattacgttgccggcgggcagccgcagttcgtcgccatgatgaacaactacgtgaagaag
ctgcatttgcaggatacccattttgaaaccgtccacgggctggatgcgccgggccagcac
agctccgcttacgatctggcggtgctctcccgggcgattattcacggcgaacctgagttc
taccatatgtacagtgagaaaagcctcacctggaacggtataactcagtacaaccgcaac
gggctgctgtgggataaatccctgaacgtcgacggtctgaaaaccggccacacctccggc
gcgggctttaatcttattgcctctgcggtagacggtcagcgccgccttattgcggtaatc
atgggcgcgcagagtccaaaaggccgggaagagcaggcgcgtaaactgctgcactgggga
caacagaattttgatacggtgcagatcctgcgcaacggtaagcaggtggggacggagcgg
atctggtacggcgataaagaaaaaatcgcgctgggcacggaacaggatttctggatggcg
ttaccaaaaacggaaattccgcatatcaaagcgaaatacgttctggatacaaaagcgctt
gaggcgccgattgccgctcaccggcgggttggggaaatcgagttgtacgaccgcgataag
ctggttgcgcactggccgctggtgacgctggaagcggtcggtaaaggcggtatgttctcg
cgcctgagcgactatttccaccataaagcctga

DBGET integrated database retrieval system