KEGG   Citrobacter rodentium: ROD_10841
Entry
ROD_10841         CDS       T01145                                 
Symbol
nleE
Name
(GenBank) T3SS effector protein NleE
  KO
K23654  T3SS secreted effector NleE
Organism
cro  Citrobacter rodentium
SSDB
Motif
Pfam: NleE
Other DBs
NCBI-ProteinID: CBG87860
UniProt: D2TT38
LinkDB
Position
1191643..1192335
AA seq 230 aa
MINPITNTQNLLSINTKHAEYVVKNIYPEIEHNYFNEPPNVYDKKYISGVTRGVAELKQE
GFINEKARRLAYMQAMYSVCPEEFKPISRNEASTPEGSWLTVISGKRPMGQFSVDSLYHP
DLHALCELPDICCKIFPKENNDFLYIVIVYRNDSPLGEQRANRFIELYNIKRDIMQELNY
ESPELKAVKSEMIIAREMGEIFGYVLEEIDSYMKNMNNKLAQIEARRSAT
NT seq 693 nt   +upstreamnt  +downstreamnt
atgattaatcccatcacaaatactcagaacttactttctataaatactaagcatgctgaa
tatgtggtgaaaaatatttacccggaaattgaacataactactttaatgaaccacccaat
gtatatgataagaagtatatatctggcgtaactagaggagtagctgaactaaaacaggaa
ggatttattaacgagaaagccaggcgacttgcttatatgcaagcaatgtattctgtatgt
ccggaagagtttaaacctatttccagaaacgaagctagtacaccggaaggcagctggcta
acagttatatccggaaaacgcccaatgggacagttttctgtagatagcttatatcatcct
gacttacatgcattgtgtgagcttccggatatttgttgcaagatcttccctaaagaaaac
aatgattttttgtatatagtgattgtgtacagaaatgacagccctctgggagaacaacga
gcaaatcgatttatagaattatataatataaaaagagacatcatgcaggaattaaattat
gaatctccagagttaaaggctgtgaaatctgaaatgattattgctcgtgaaatgggagag
atctttggctatgtgttggaggaaatagatagttatatgaaaaatatgaataataaactt
gctcaaattgaggcgagaaggtcagccacttag

DBGET integrated database retrieval system