KEGG   Citrobacter rodentium: ROD_15071
Entry
ROD_15071         CDS       T01145                                 
Symbol
marA
Name
(GenBank) multiple antibiotic resistance regulatory protein
  KO
K13632  AraC family transcriptional regulator, mar-sox-rob regulon activator
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_15071 (marA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cro03000]
    ROD_15071 (marA)
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:cro01504]
    ROD_15071 (marA)
Transcription factors [BR:cro03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    ROD_15071 (marA)
Antimicrobial resistance genes [BR:cro01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, repression of porin OmpF [MD:M00746]
    ROD_15071 (marA)
SSDB
Motif
Pfam: HTH_18 HTH_AraC Terminase_5 CPSase_L_D3
Other DBs
NCBI-ProteinID: CBG88271
UniProt: D2TIE4
LinkDB
Position
complement(1603003..1603383)
AA seq 126 aa
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRS
RKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRITNMHGESRYLH
PLNHCN
NT seq 381 nt   +upstreamnt  +downstreamnt
atgtccagacgcaatactgacgctatcaccattcacagcattttggactggatcgaagat
aacctggaatcgccgctctcactggaaaaagtgtctgagcgttcaggttactccaaatgg
cacctgcaacggatgttcaaaaaagagaccggtcattcattaggccagtacatccgcagc
cgtaaaatgaccgaaatagcgcagaaattaaaagaaagtaacgagccgattttatatctg
gccgagcgctacggttttgagtcgcagcagacgctgacccggacctttaaaaactatttc
gacgtgccgccgcataaataccgtattaccaatatgcatggcgaatcgcgttacctgcat
ccgttgaatcactgtaactaa

DBGET integrated database retrieval system