KEGG   Citrobacter rodentium: ROD_16751
Entry
ROD_16751         CDS       T01145                                 
Symbol
mppA
Name
(GenBank) periplasmic murein tripeptide binding protein
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro02010  ABC transporters
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_16751 (mppA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_16751 (mppA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_16751 (mppA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_16751 (mppA)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    ROD_16751 (mppA)
SSDB
Motif
Pfam: SBP_bac_5 DUF4038
Other DBs
NCBI-ProteinID: CBG88433
UniProt: D2TK91
LinkDB
Position
complement(1784295..1785908)
AA seq 537 aa
MKHSVSVTCCALLVSSISLSYAAEVPKGTVLAEKQELVRHIKDEPATLDPAKAVGLPEIQ
VIRDLYEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNARWSDGTPVTAQDFVYSWQ
RLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDKLGVSAPDARTLKVQLDKPLPWFANL
TANFAFYPVQKANVESGKDWTRPGKLTGNGAYVLNDRVVNEKLVVVPNTHYWDSAKTILQ
KVTFLPINQESAATKRYLAGDIDITESFPKNLYQKLLKDIPGQVYTPPQLGTYYYAFNTQ
KGPTADSRVRLALSMTIDRRIMAEKVLGTGEKPAWRFTPDVTAGFTPDPSPFEQMSQEEL
NAQAKTLLRAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTY
IDSRNTGNFDVIRASWVGDYNEPSTFLSLLTSTHSGNISRFNNPAYDKVLAQATTENTVE
ARNADYNAAEKILAEQAPIAPIYQYTNGRLIKPWLKGYPITNPEDVAYSRTMYIVKH
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgaagcactctgtttcagtcacctgttgtgcgctgttggtgagcagcatttctctgtca
tatgctgcggaggttcccaaaggcacggtactggcagagaagcaggagctggttcgtcat
attaaagatgagccggcaacgcttgacccggctaaagcggtcggactaccggaaatccag
gttattcgcgatctttacgaagggctggtaaatcagaacgaaaaaggggagatcgttccc
ggcgtcgctacccagtggaaaagtaacgacaatcgcatctggacgtttaccctgcgtgat
aatgcccgctggtcggacggcacgccggtaaccgcgcaggattttgtttacagctggcag
cggctggttgacccgaaaacgctctctccctttgcgtggttcgccgcgctggcggggatt
aataacgcgcaggcaattatcgatggcaaagcgacgccggacaagcttggcgtcagcgcg
ccggacgcccgcaccctgaaagtgcagctggacaaaccgctgccgtggtttgcgaatctg
accgcgaattttgccttttacccggtgcaaaaagccaatgtggaaagcggtaaagactgg
accagacccgggaaactgacgggtaacggcgcctacgttttaaacgatcgcgtggtgaat
gaaaagctggtcgtggtgccgaatacccattactgggacagcgcgaagacgattctgcaa
aaagtgaccttcctgccgatcaatcaggagtccgctgcgacgaaacgctatctggctggc
gatatcgatatcactgaatctttcccgaaaaatctgtaccagaaactgctgaaagacatt
cccggccaggtctacacgccgccgcaactgggaacctattattacgcgtttaatacgcag
aaagggccgacggcggattcccgcgtgcgtctggcgctgagcatgaccattgaccggcgg
attatggctgaaaaggtgctgggaaccggcgaaaaaccggcctggcgttttacgccggat
gtcacggcgggcttcacgccggatccgtctccttttgagcagatgagtcaggaagagctg
aacgcgcaggcgaaaacgctgcttcgtgcggcaggctacggtccgcagaagccgctgaag
ctgacgcttttgtacaacacctcagaaaaccaccagaagatcgccattgcggtggcttct
atgtggaagaaaaacctgggcgtggatgtaaaactgcaaaaccaggagtggaaaacctat
atcgacagccgcaacaccggaaactttgatgtgatccgcgcttcatgggtaggggattac
aacgagccgtcaacttttctgtcgctgctgacgtcgacccattctggcaatatctcccgt
tttaacaacccggcgtatgataaagtgctcgcccaggcgacgacggagaataccgttgag
gcgcgtaacgcagattataatgcggcagagaaaatcctcgcggaacaggcgccgatcgcg
ccaatttatcaatataccaatggccgactgattaaaccctggctgaaagggtatcctatt
actaacccggaagatgtcgcttatagccggacaatgtatattgtgaagcattga

KEGG   Citrobacter rodentium: ROD_17611
Entry
ROD_17611         CDS       T01145                                 
Symbol
oppF
Name
(GenBank) oligopeptide ABC transporter, ATP-binding protein
  KO
K10823  oligopeptide transport system ATP-binding protein
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro02010  ABC transporters
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_17611 (oppF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_17611 (oppF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_17611 (oppF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_17611 (oppF)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    ROD_17611 (oppF)
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_22 SMC_N PRK AAA TniB AAA_29 NACHT AAA_16 RsgA_GTPase MMR_HSR1 AAA_25 RNA_helicase MobB MeaB AAA_13
Other DBs
NCBI-ProteinID: CBG88518
UniProt: D2TL69
LinkDB
Position
complement(1868069..1869073)
AA seq 334 aa
MNAVDEKRKVLLEIADLKVHFDIKDGRQWFWQPSKTLKAVDGVTLRLYEGETLGVVGESG
CGKSTFARAIIGLVRATAGRVAWLGKDLLGMSPEQWREVRSDIQMIFQDPLASLNPRMTI
GDIIAEPLRTYHPKLSRQEVRDRVKAMMLKVGLLPNLINRYPHEFSGGQCQRIGIARALI
LEPKLIICDEPVSALDVSIQAQVVNLLRQIQREMGLSLIFIAHDLAVVKHISDRVLVMYL
GHAVELGTYDEVYHNPLHPYTKALMSAVPIPDPDLEKNKTIQLLEGELPSPINPPSGCVF
RTRCPIAGPECAQTRPVLEGSFRHAVSCLKVDPL
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaatgctgtagatgagaaacgtaaagtcctccttgaaattgccgatctgaaggtgcat
ttcgatatcaaagatggcaggcagtggttctggcagccctcaaaaacgctgaaggcggtc
gatggcgtgacgctgcgtctgtatgaaggggaaacgctgggggtggttggcgagtccggc
tgcggcaaatcgaccttcgccagggcgatcatcggactggtcagggcgaccgccgggcgc
gtcgcgtggctgggcaaagatttgctgggaatgagtccggaacagtggcgcgaagtccgc
agcgacattcagatgattttccaggatccgctggcctcgctgaacccgcggatgaccatc
ggcgacattatcgcagagccgctgcggacctatcatccaaagctgtcgcgccaggaagtg
cgcgatcgggtaaaagcgatgatgctgaaggtgggcctgttgccgaatctgattaaccgt
tatccgcatgagttctccggcggccagtgtcagcgcatcggcattgcccgggcgctgatt
cttgagccgaagcttatcatttgcgatgagccggtttcggcgctggacgtctctatccag
gcgcaagtggtcaacctgttgcggcaaatccagcgggagatggggctgtcgctgatcttc
atcgcccatgatctggcggtggtgaaacatatctccgaccgcgtgctggtgatgtatctg
gggcacgcggtggagctgggcacctatgacgaggtgtatcataacccgctacatccctac
accaaagcgctgatgtctgcggtgccaatccccgatcccgatctggaaaagaataagacc
attcagcttctggaaggggagttgccgtcgcccatcaatccgccttcaggctgcgtattt
cgcacccgctgtccgatagccggaccggaatgcgcgcaaacgcggccggtgcttgagggc
agtttccgccatgccgtttcctgcctcaaagtagacccgttataa

KEGG   Citrobacter rodentium: ROD_17621
Entry
ROD_17621         CDS       T01145                                 
Symbol
oppD
Name
(GenBank) oligopeptide ABC transporter, ATP-binding protein
  KO
K15583  oligopeptide transport system ATP-binding protein
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro02010  ABC transporters
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_17621 (oppD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_17621 (oppD)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_17621 (oppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_17621 (oppD)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    ROD_17621 (oppD)
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 ABC_ATPase SQHop_cyclase_C
Other DBs
NCBI-ProteinID: CBG88519
UniProt: D2TL70
LinkDB
Position
complement(1869070..1870083)
AA seq 337 aa
MSVIETAAAPLAQQRANALLDVKDLRVTFSTPDGDVTTVNDLNFTLRAGETLGIVGESGS
GKSQTAFALMGLLAANGRTGGSAVFNGREILNLPERELNRLRAEQMSMIFQDPMTSLNPY
MRVGEQLMEVLILHKGMSKAEAFEESVRMLDAVKMPEARKRMKMFPHEFSGGMRQRVMIA
MALLCRPKLLIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLGVVAGICDKVL
VMYAGRTMEYGNARDVFYRPVHPYSIGLLGAVPRLDAEGEEMLTIPGNPPNLLRLPQGCP
FQPRCPWAMEVCSSTPPLEEFSPGRLRACFKPVEDLV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgagcgtaattgaaaccgcagccgcgccgctggcgcagcaaagggctaacgcactgctg
gatgtaaaagatcttcgcgtgaccttcagtaccccggatggcgatgtcaccaccgtcaac
gacctgaactttacgctgcgtgccggggaaaccttaggcattgtcggtgagtccggttca
ggcaaatcgcagaccgcctttgcgctgatggggctgttggcggcaaatggccggaccggc
ggttcggcggtctttaacggccgcgaaatcctcaatttgccggagcgcgaactgaacagg
ctacgcgccgagcaaatgtcgatgattttccaggacccgatgacgtcgctgaacccgtat
atgcgcgttggcgagcagctgatggaggtgctgatcctgcataaaggcatgagcaaggcc
gaggcgttcgaggagtccgtgcgtatgcttgatgcggtcaaaatgcctgaagcgcgcaag
cgtatgaaaatgttcccgcatgaattttccggcgggatgcgtcagcgcgtgatgattgcg
atggcgctgctgtgtcggccaaaactgctgattgccgatgaaccgacgacagcgctggac
gtgaccgtgcaggcgcaaatcatgaccttgctcaacgagctgaagcgggaatttaatacc
gccatcattatgattactcacgatcttggcgtcgtcgcggggatttgcgacaaagttctg
gtgatgtatgcggggcggacgatggagtacggtaacgcacgcgatgtcttttatcgcccg
gttcatccctattcgattggtctgctgggcgcggtgccgcgcctcgatgccgaaggggaa
gagatgctgactattccgggtaacccgccgaacctgctgcgtttaccgcaaggctgcccg
tttcagccgcgctgtccctgggcgatggaggtatgcagcagcacgccgccgctggaggag
ttcagtccggggcggctgcgcgcctgctttaaaccggtggaggatctggtatga

KEGG   Citrobacter rodentium: ROD_17631
Entry
ROD_17631         CDS       T01145                                 
Symbol
oppC
Name
(GenBank) oligopeptide ABC transporter, permease protein
  KO
K15582  oligopeptide transport system permease protein
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro02010  ABC transporters
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_17631 (oppC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_17631 (oppC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_17631 (oppC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_17631 (oppC)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    ROD_17631 (oppC)
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: CBG88520
UniProt: D2TL71
LinkDB
Position
complement(1870095..1871003)
AA seq 302 aa
MMLSKKNSEALENFSDKLEVEGRSLWQDARRRFMHNRAAVASLIVLAIIALFVTLAPMLS
QFTYFDTDWGMMSSAPDVESGHYFGTDSSGRDLLVRVAIGGRISLMVGIAAALVAVVVGT
LYGSLSGYLGGKIDSVMMRLLEILNSFPFMFFVILLVTFFGQNILLIFVAIGMVSWLDMA
RIVRGQTLSLKRKEFIEAAQVGGVSTASIVTRHIVPNVLGVVVVYASLLVPSMILFESFL
SFLGLGTQEPLSSWGALLSDGANSMEVSPWLLLFPAGFLVVTLFCFNFIGDGLRDALDPK
DR
NT seq 909 nt   +upstreamnt  +downstreamnt
atgatgttaagtaagaaaaacagcgaggcgctggaaaatttcagtgacaagctggaggtc
gaagggcgcagcctgtggcaggacgcccggcgccgttttatgcataaccgcgcggcggtc
gccagtctgattgtgctggcgataattgccctgtttgtgacgctggcgccgatgctgtcg
cagtttacctatttcgataccgactgggggatgatgtccagcgcgccggacgtcgaatca
gggcactattttggcaccgactcgtccggacgcgacctgctggtgcgcgtggcgattggc
gggcggatttcgctgatggttgggatcgccgcggcgctggtcgcggtggtggtcgggacg
ttgtatggctcgctgtcgggctacctgggcggcaaaatcgactcggtgatgatgcgcctg
ctggagatcctcaactcgttcccgtttatgtttttcgtcattctgctggtgacctttttc
gggcaaaacatcctgctgatctttgtcgccatcggcatggtctcctggctggatatggcg
cgtatcgtacgcgggcagacgttaagcctgaagcggaaagagtttatcgaagcggcgcag
gtcggcggcgtctccaccgccagtattgttactcgccatatcgtgcctaacgtgctgggc
gtggtggtggtttacgcttcgttgctggtgcccagcatgatcctgtttgagtccttcctg
agcttccttggcctcgggactcaggaaccgctgagcagctggggggcgttactgagcgat
ggcgcgaactccatggaggtgtcgccgtggcttttgctgttcccggcggggttcctggtg
gtgaccctgttctgttttaactttattggcgacggcctgcgtgatgccctcgacccgaaa
gaccgttaa

KEGG   Citrobacter rodentium: ROD_17641
Entry
ROD_17641         CDS       T01145                                 
Symbol
oppB
Name
(GenBank) oligopeptide ABC transporter, permease protein
  KO
K15581  oligopeptide transport system permease protein
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro02010  ABC transporters
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_17641 (oppB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_17641 (oppB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_17641 (oppB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_17641 (oppB)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    ROD_17641 (oppB)
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N
Other DBs
NCBI-ProteinID: CBG88521
UniProt: D2TL72
LinkDB
Position
complement(1871018..1871938)
AA seq 306 aa
MLKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGERALPPEVLANIEAKYHLNDPIM
TQYFSYLKQLAHGDFGPSFKYKDYTVNDLVASSFPVSAKLGAAAFLLAVILGVSAGVIAA
LKQNTRWDYTVMGIAMTGVVIPSFVVAPLLVMIFAITLQWLPGGGWNGGALKFMILPMVA
LSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIIFRHALKPALLPVLSYMGPAF
VGIITGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGTLTIVFNAIVDVLYAVI
DPKIRY
NT seq 921 nt   +upstreamnt  +downstreamnt
atgttgaaatttattttacgccgctgtctggaagcgattccgacgctgtttattcttatt
accatttcgttttttatgatgcgtctggcgccgggaagtcctttcaccggcgaacgcgcg
ttaccgccagaggtgctggcgaatatcgaagcgaaataccatctgaacgacccgatcatg
actcagtacttcagctatctgaagcagctggcgcacggcgatttcgggccctcttttaag
tacaaagattacaccgttaacgacctggtggcctcgagctttccggtttctgcgaagctg
ggtgcggccgccttcctgctggcggtgatcctcggcgtaagcgccggagtgattgccgcg
ctgaagcaaaatacgcgctgggattatacggtgatggggatagcgatgaccggagtggtg
atacccagcttcgtggtcgcccctctgctggtgatgatattcgccatcactctgcaatgg
ctgcccggcggcggctggaacggcggggcgctgaaatttatgatcctgccaatggtcgcc
ttatcgctggcctatatcgccagcatcgcccgtattacccgcggttcgatgatcgaagtg
ctgcactccaatttcatccgcaccgcgcgggcgaaggggctgccgatgcggcggatcatc
tttcgccacgcgctgaagcccgcgctgctgccggtgctttcgtatatgggaccggcattt
gtcgggattatcaccggttcaatggtcattgaaacgatttatggcctgcccggcatcggg
cagctgtttgtcaacggcgcgctgaaccgcgattactcgctggtgctgagcctgacgatt
ctggtcgggacattgactatcgttttcaacgcgatcgttgatgtgctgtatgccgtaatc
gacccgaaaattcgttactga

KEGG   Citrobacter rodentium: ROD_17651
Entry
ROD_17651         CDS       T01145                                 
Symbol
oppA
Name
(GenBank) oligopeptide ABC transporter, substrate-binding protein
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro02010  ABC transporters
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_17651 (oppA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_17651 (oppA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_17651 (oppA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_17651 (oppA)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    ROD_17651 (oppA)
SSDB
Motif
Pfam: SBP_bac_5
Other DBs
NCBI-ProteinID: CBG88522
UniProt: D2TL73
LinkDB
Position
complement(1872059..1873687)
AA seq 542 aa
MTTTKKSLVAAGIFSALIAGNAAMAADVPAGVQLAEKQTLVRNNGSEVQSLDPHKIEGVP
ESNVSRDLFEGLLVSDVEGKPSPGVAEKWENNDFKVWTFHLRKDAKWSDGSPVTAQDFVY
SWQRLANPNTASPYASYLQYGHIVNIDDIVAGKKPVTELGVKAVDDHTFEVTLSEPVPYF
YKLLVHPSVSPVPKAVVEKFGDKWTQPANIISNGAYKLKDWVVNERIVLERNPQYWDNAK
TVINHVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPDEVHVDPYLCTYYY
EINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSFTPPYTDGAKLVEPEWFGW
TQEKRNEEAKKLLAEAGYTADKPLTFNLLYNTSDLHKKLAIAASSIWKKNLGVNVKLENQ
EWKTFLDTRHQGNFDVARAAWCADYNEPTSFLNMVLSDSSNNTTFYKSPTFDGIIADTLK
AKDEAQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPMDNIYVKNLYII
KH
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgaccaccacgaaaaaaagtttagtcgccgcaggcattttctcagcgttaatcgccggt
aatgcggcaatggcagcggatgttcccgcaggcgttcagctggcggaaaagcagacgctg
gtgcgtaataacggctcggaagtgcaatccctcgacccgcataaaattgaaggggtgccg
gaatcaaacgtcagccgcgatctatttgaaggattattagtcagtgacgtggagggtaag
ccgtctccgggcgtcgcggaaaaatgggaaaacaacgattttaaggtctggactttccat
ctgcgtaaagacgcaaaatggtccgacggttcccccgttaccgcgcaggattttgtctac
agctggcagcgtctggctaatccgaataccgcctcgccgtatgccagctatctgcaatat
ggccatatcgtcaatattgacgatattgtggccggtaaaaagccggtcaccgaactgggc
gtgaaagccgtcgacgaccatacctttgaagtgacgctgagcgagccggttccctatttc
tataaactgctggtgcatccatccgtttcgccagtaccgaaagcagtggttgaaaaattc
ggcgataaatggacgcagcctgccaatatcatcagcaacggcgcctataagctgaaagac
tgggtggttaacgaacgtatcgtccttgagcgtaaccctcagtactgggataacgcgaaa
accgtgattaaccatgtgacctatctgccgatctcctccgaagtgaccgacgttaaccgc
taccgtagcggcgaaatcgacatgacctataacaacatgccgattgaactgttccagaag
ctgaagaaagagatcccggatgaggttcacgtcgacccttatctctgcacctattattac
gaaattaataaccagaaagcgccgtttaacgatgtgcgcgtgcgtaccgcgctgaagctc
gcgctggatcgcgacatcatcgtcaataaagtgaaaaatcagggcgacctgccggcctat
agctttaccccgccttacaccgacggggcgaaactggtcgagccggaatggtttggctgg
acgcaggaaaagcgcaatgaagaggcgaaaaaactgctggccgaggccggttacaccgca
gataagccgctgaccttcaacctgctgtacaacacctccgatctgcacaagaagctggcc
attgcggcttcctcaatctggaagaaaaatttaggcgtcaacgtgaagctggagaaccag
gagtggaaaaccttcctggatacgcgccatcaggggaactttgatgtcgcccgcgcggca
tggtgcgcagattataacgaaccgacttcgttcctgaacatggtgctgtccgacagttca
aacaatacgacgttctataagagcccgacatttgacggcattattgctgataccttaaag
gcgaaagatgaggcgcagcgatccgagctgtacgctaaagctgagcagcagcttgataaa
gattcggcgatcgtgccggtgtattactacgtgaatgcccgtctggtgaaaccgtgggtt
ggcggttacaccggtaaggatccgatggataatatctacgttaagaacttgtatattatc
aagcattaa

DBGET integrated database retrieval system