KEGG   Citrobacter rodentium: ROD_17081
Entry
ROD_17081         CDS       T01145                                 
Symbol
sapC
Name
(GenBank) peptide ABC transporter, permease protein
  KO
K19228  cationic peptide transport system permease protein
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_17081 (sapC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_17081 (sapC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_17081 (sapC)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Cationic peptide transporter
    ROD_17081 (sapC)
SSDB
Motif
Pfam: BPD_transp_1 OppC_N Chal_sti_synt_N
Other DBs
NCBI-ProteinID: CBG88466
UniProt: D2TKC3
LinkDB
Position
1818666..1819556
AA seq 296 aa
MPYDSVYSEKRPPGTLRTAWRKFYSDTPAMIGLYGCAGLALLCLFGGWFAPYGIDQQFLG
YQLLPPSWSRYGEVSFFLGTDDLGRDVLSRLLSGAAPTVGGAFIVTVAATLCGLLLGVVA
GATHGLRSAVLNHILDTLLSIPSLLLAIIVVAFAGPHLGHAMFAVWLALLPRMVRSVYSM
VHDELEKEYVIAARLDGATTLNILWFAVLPNITAGLVTEITRALSMAILDIAALGFLDLG
AQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRAIIAGVE
NT seq 891 nt   +upstreamnt  +downstreamnt
atgccttacgatagcgtttatagcgaaaagcgcccaccgggaacgctgcgcaccgcgtgg
cgcaaattttacagcgataccccggcaatgatcggcctgtatggctgcgccgggctggcg
ctgctgtgtctgttcggcggctggttcgcgccctatggcatcgatcagcagttcctcggc
taccagctactgccgccctcctggtcgcgctatggcgaagtctcgttctttctcggcaca
gacgatctcgggcgtgacgtgctcagccgtctgctcagcggcgcggccccgacggtgggc
ggcgcgtttatcgtcacggtcgcggcgacgctttgcggcctgctgctgggcgtggtggcc
ggcgctacccacggcctgcgctcggcggtgctgaaccatattcttgatacgctgctgtcg
attccttcgctgctgctggccatcatcgtggtggccttcgcagggccgcatctgggccat
gcgatgtttgccgtctggctggcgctgctgccgagaatggtgcgctcagtttacagcatg
gtgcatgacgaactggaaaaagagtacgttatcgccgcgcggcttgacggcgcaaccacg
ctgaatatcctctggtttgccgtgctgcccaatattaccgccgggctggtcacggagatc
acccgcgcgctgtcgatggcgattctggatattgcggcgctcggctttctcgatctcggc
gcgcagcttccttcgccggaatggggcgcaatgcttggcgacgcgctggagttgatttac
gtcgcgccgtggacggtgatgctgcccggcgccgctattatgattagcgtgctgctggtc
aatctgcttggcgacggcgtgcgtcgcgccatcattgcgggggtggaataa

DBGET integrated database retrieval system