KEGG   Citrobacter rodentium: ROD_17101
Entry
ROD_17101         CDS       T01145                                 
Symbol
sapF
Name
(GenBank) peptide ABC transporter, ATP-binding protein
  KO
K19230  cationic peptide transport system ATP-binding protein
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROD_17101 (sapF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_17101 (sapF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_17101 (sapF)
Transporters [BR:cro02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Cationic peptide transporter
    ROD_17101 (sapF)
SSDB
Motif
Pfam: ABC_tran AAA_22 SMC_N RsgA_GTPase AAA_29 DUF87 AAA_21 ABC_ATPase AAA_15 AAA_23 AAA_16 NACHT AAA_33 AAA_24 AAA_10 AAA G-alpha DUF2847 AAA_18 Utp12 Sigma54_activat RNA_helicase Zeta_toxin AAA_13 MMR_HSR1
Other DBs
NCBI-ProteinID: CBG88468
UniProt: D2TKC5
LinkDB
Position
1820550..1821356
AA seq 268 aa
MVETLLEVRNLSKTFRYRTGWFRRQTVEAVKPLSFTLRERQTLAIIGENGSGKSTLAKML
AGMVEPSGGELLIDDHPLNFGDYSFRSQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTD
LEPEQRRKQIIDTMRMVGLLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALAS
LDMSMRSQLINLMLELQEKQGISYIYVTQHLGMMKHISDQVLVMHQGEVVERGSTADVLA
SPLHELTKRLIAGHFGEALTADAWRKDR
NT seq 807 nt   +upstreamnt  +downstreamnt
atggtcgaaaccttactcgaagtgcgtaatctgagtaaaaccttccgctatcgcaccggc
tggtttcgacgtcagaccgtggaggcggtgaagccgttgagctttaccctgcgtgagcgc
cagacgctggcgatcattggcgagaacggctccggtaagtcgacgctggcgaaaatgctg
gccggaatggtcgaaccgagcggcggcgaactgctgattgacgatcatccgctgaacttt
ggcgattactcctttcgcagccagcgcatccggatgatttttcaggacccgtcgacatcg
ctcaacccgcgccagcgtatctcgcaaattctcgatttcccgctgcgtctgaatactgat
ctggagccggagcagcgccgtaagcagattattgacaccatgcgtatggttggcctgctg
cccgatcacgtcagctactatccgcacatgctggcgccggggcagaagcagcgtctcggt
ctggcgcgggcgctgattttacgcccgaaggtcatcattgccgatgaggcgctggcttcg
ctcgatatgtcgatgcgctcgcagttaattaacctgatgctggaattgcaggagaaacag
ggtatctcttatatttacgtcacccagcaccttggcatgatgaaacacatcagcgatcag
gttttagttatgcatcagggcgaggtggtggagcgcggcagtaccgccgacgttctggcc
tcgccgctgcatgaactgacgaagcgtttaatcgccggtcactttggcgaggcgctaacc
gccgatgcgtggcgaaaagatcgctaa

DBGET integrated database retrieval system