KEGG   Citrobacter rodentium: ROD_19441
Entry
ROD_19441         CDS       T01145                                 
Symbol
flhC
Name
(GenBank) flagellar transcriptional activator
  KO
K02402  flagellar transcriptional activator FlhC
Organism
cro  Citrobacter rodentium
Pathway
cro02020  Two-component system
cro02024  Quorum sensing
cro02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_19441 (flhC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_19441 (flhC)
  09142 Cell motility
   02040 Flagellar assembly
    ROD_19441 (flhC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cro02035]
    ROD_19441 (flhC)
Bacterial motility proteins [BR:cro02035]
 Flagellar system
  Flagellar assembly proteins
   Stator
    ROD_19441 (flhC)
SSDB
Motif
Pfam: FlhC
Other DBs
NCBI-ProteinID: CBG88696
UniProt: D2TMY7
LinkDB
Position
complement(2065783..2066361)
AA seq 192 aa
MSEKSIVQEARDIQLAMELITLGARLQMLESETQLSRGRLIKLYKELRGSPPPKGMLPFS
TDWFMTWEQNIHASMFCNAWQFLLKTGLCSGVDAVIKAYRLYLEQCPHGEDGPLLALTRA
WTLVRFVESGLLQLSGCSCCGGNFITHAHQPAGSFACSLCQPPSRAVKRRKLSQDAADII
PQLLDEQIEQAV
NT seq 579 nt   +upstreamnt  +downstreamnt
atgagtgaaaaaagcattgttcaggaagctcgcgatatccagctggcgatggaattgatc
accctgggcgcccgtttgcaaatgctggaaagcgaaacgcaattaagtcgtggtcgcctc
atcaaattgtataaagaactccgcggcagcccgccgccgaaagggatgctgccgttttcc
acggactggtttatgacctgggagcaaaacattcatgcctccatgttctgtaacgcatgg
cagtttttgctcaaaaccggactgtgcagcggggtggacgcggtcattaaagcctaccga
ctgtaccttgagcagtgtccgcacggcgaagatggaccgctgctggcgttaacccgcgcc
tggacgctggttcgtttcgttgagagtggtttgttacagctgtcgggctgcagctgctgc
ggcggtaattttattacccatgcccatcaaccggctggcagtttcgcctgcagtttatgc
cagccgccttccagggcggtaaaaagacgtaaactttcccaggatgctgccgatattatt
ccacaactgctggatgaacagatcgaacaggctgtttaa

DBGET integrated database retrieval system