KEGG   Citrobacter rodentium: ROD_19711
Entry
ROD_19711         CDS       T01145                                 
Symbol
sdiA
Name
(GenBank) regulatory protein
  KO
K07782  LuxR family transcriptional regulator, quorum-sensing system regulator SdiA
Organism
cro  Citrobacter rodentium
Pathway
cro02020  Two-component system
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_19711 (sdiA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_19711 (sdiA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cro03000]
    ROD_19711 (sdiA)
Transcription factors [BR:cro03000]
 Prokaryotic type
  Helix-turn-helix
   LuxR family
    ROD_19711 (sdiA)
SSDB
Motif
Pfam: Autoind_bind GerE Sigma70_r4_2 HTH_38 HTH_20
Other DBs
NCBI-ProteinID: CBG88722
UniProt: D2TNM8
LinkDB
Position
complement(2088975..2089697)
AA seq 240 aa
MQATDFFTWRRSMLLRFQEMASAKDVYSELQRQAQLLEFDYYALYVRHPVPFTRPRISFQ
TSYPEAWVSRYQAENYSAIDPVLKPENFIQGHLPWSDDLFNDAQTLWDAARAHGLRKGVT
QCVMLPNRALGFLSVVRASLRSNPIDDDEVELRLQLLVRESLAALSRLEDEMVMAPEMRF
SKREKEILKWTAEGKTSYEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGLI
NT seq 723 nt   +upstreamnt  +downstreamnt
atgcaggcgacagatttttttacctggcggcggtcgatgctcttacgctttcaggaaatg
gcaagcgcaaaagatgtttacagtgaattacaacgtcaggcgcaattgctggaatttgat
tattacgcgctgtatgtcagacatccggttccgtttacccgtcccagaatatccttccag
acctcctatcccgaggcgtgggtttcccggtatcaggcagaaaattattccgctatcgat
ccggtgctgaagccggaaaatttcatccagggacatttgccgtggagcgacgacttattc
aacgatgcgcagacattgtgggacgcagcgcgcgcgcatggtttacgcaaaggcgtaacg
cagtgcgtcatgttgccgaaccgggcgctgggctttctttccgtcgtgcgcgcgagtctg
cggagtaaccctattgacgacgacgaagtggagctgaggctgcaactgctggttcgggag
agtctggcggcgctttcccgactggaagatgaaatggtgatggcgccagagatgcgcttc
agtaagcgggaaaaggagattctgaagtggaccgcggaagggaagacctcttatgaaatt
gcgatgatcctgtcgatatcagaaaacaccgttaattttcatcagaagaatatgcagaag
aaattcaatgcccctaacaagacgcaggttgcctgctatgccgctgcaaccgggttaatc
tga

DBGET integrated database retrieval system