KEGG   Citrobacter rodentium: ROD_23921
Entry
ROD_23921         CDS       T01145                                 
Symbol
amiA
Name
(GenBank) probable N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_23921 (amiA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_23921 (amiA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cro03036]
    ROD_23921 (amiA)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     ROD_23921 (amiA)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   ROD_23921 (amiA)
Chromosome and associated proteins [BR:cro03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ROD_23921 (amiA)
SSDB
Motif
Pfam: Amidase_3 TAT_signal
Other DBs
NCBI-ProteinID: CBG89137
UniProt: D2TT79
LinkDB
Position
2513956..2514825
AA seq 289 aa
MSTFKPLKILASRRQVLKAGLAALTISGMSNATAKDAPLKTSNGHSQPAKKKSGGRRIVV
LDPGHGGIDTGAIGRNGSKEKHVVLAIAKNVRSILRSQGYDCRLTRSGDTFIPLYDRVEI
AHKHGADLFMSIHADGFTNPSAAGASVFALSNRGASSAMAKYLSDRENRADEVAGKKATD
KDHLLQQVLFDLVQTDTIKNSLTLGSHILKKIKPVHKLHSRSTEQAAFVVLKSPSIPSVL
VETSFITNPEEERLLGTTAFRQKIATAIANGVVSYFHWFDNQKAHSKKR
NT seq 870 nt   +upstreamnt  +downstreamnt
atgagcacttttaaacccctaaaaattctcgcatcacgccgccaggtgctgaaagccgga
ctggctgccctgacgatttcggggatgagcaacgccaccgcaaaagacgcccctctgaaa
accagcaacggtcacagccagcccgcaaagaaaaaatccggcggcagacggatcgtggtg
ctggaccccggacacggcggcattgacaccggcgctatcgggcgtaatggctcgaaagaa
aagcacgttgtgctggcgattgcaaaaaacgtacgttctattttgcgcagccagggatac
gactgccgcctgacgcgatccggcgataccttcatcccgctgtatgaccgggtggagatc
gcccacaagcacggcgcggatctgtttatgtccattcacgccgatggctttaccaatccg
agcgcggccggggcgtcggtgttcgccctgtccaaccgcggggccagtagcgcgatggcg
aaatacctttccgatcgcgaaaaccgtgctgacgaagtggccgggaaaaaagcgaccgat
aaagatcacctgttgcagcaggtgctgttcgatctggtgcagaccgacaccatcaaaaac
agcctgaccctcggctcgcatattctgaaaaagatcaagccggtgcataagctgcacagc
cgttcaacggaacaggcggcgtttgtggtgctaaaatcaccgtcaattccgtcggtgctg
gtggaaacctcgtttatcaccaatccggaagaagagcgcctgctgggcaccaccgcgttc
cggcagaaaatcgccaccgctatcgccaatggcgtggtcagctatttccactggttcgat
aaccagaaagcccactcgaagaagcgctga

KEGG   Citrobacter rodentium: ROD_28591
Entry
ROD_28591         CDS       T01145                                 
Symbol
amiC
Name
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_28591 (amiC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_28591 (amiC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cro03036]
    ROD_28591 (amiC)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     ROD_28591 (amiC)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   ROD_28591 (amiC)
Chromosome and associated proteins [BR:cro03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ROD_28591 (amiC)
SSDB
Motif
Pfam: Amidase_3 AMIN
Other DBs
NCBI-ProteinID: CBG89599
UniProt: D2TIN7
LinkDB
Position
complement(3023201..3024454)
AA seq 417 aa
MSGTNPPISRRRLLQGAGAMWLLSVSQVGLAAVSQIVAVRIWPASSYTRVTVESNRQLKY
KQFALSNPERVVVDIEDVNLNSVLKGMAAQIRPDDPYIKSARVGQFDPQTVRMVFELKQN
VKPQLFALAPVAGFKERLVMDLYPANAQDMQDPLLALLEDYNRGDLDKQVPPAQSGPQPG
KAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRALIEKEGNMKVYMTRNE
DIFIPLKVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQN
ASDLIGGVSKSGDRYVDHTMFDMVQSLTIADSLKFGKAVLNKLSKINNLHKNQVEQAGFA
VLKAPDIPSILVETAFISNIEEERKLKTAKFQQEVAESILAGIKAYFADGATLARRG
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtcgggaaccaatccacccatcagccgccgtcgtttactgcaaggggcgggcgccatg
tggctattgagcgtcagtcaggtcggtctggctgccgtcagtcagattgttgcggttcgt
atctggcccgcatcgagttatacccgcgttacggtggaatcgaaccgacagctgaaatat
aagcagtttgccctgagcaatcccgaacgcgtggttgtggatattgaagatgtgaatttg
aactccgtgctgaagggcatggcggcgcaaattcgtcctgacgatccttacatcaagtcg
gcgcgggtggggcagttcgatccgcagaccgttcgtatggtgtttgagctgaaacaaaac
gtgaagccgcagctgtttgcgctggcgccagtggccggatttaaggaacgcctggtgatg
gatctttatcctgccaatgcgcaggatatgcaggatccgctgctggcgctgcttgaggac
tacaacagaggcgatcttgataagcaggtgccgcctgcgcagagcggaccgcagccgggg
aaagccgggcgcgatcgtccgattgtgatcatgctcgatccgggacacggcggcgaggac
tccggcgcggtaggcaaatataaaacgcgggaaaaagatgtggtgttgcagatcgccagg
cgtttacgggcgctgatcgaaaaagagggcaacatgaaggtctatatgacgcgtaatgaa
gatatctttattccgctgaaggtgcgcgtggccaaggcgcagaagcagcgtgcagacctg
tttgtatcgattcacgccgatgcgttcaccagccgccagcccagcggttcttcggtattt
gccctgtcgaccaaaggcgccaccagtaccgcggcgaaatacctggcgcagacgcagaac
gcctccgacttaattggcggggtcagcaaaagcggcgatcgctatgttgaccataccatg
ttcgatatggtgcagtcgctgaccattgccgacagcctgaaatttggtaaagcggtgctg
aacaagctcagtaagattaacaatctgcataagaatcaggtggaacaggcgggctttgcg
gtcctgaaagcgccggatattccgtcgatcctcgtcgaaacggcgtttatcagcaacatt
gaggaggagcgtaagctcaaaacggcgaagttccagcaggaggtggcggagtcgatttta
gccggaattaaggcctattttgccgacggggcgacgctggcgagaagaggataa

KEGG   Citrobacter rodentium: ROD_32291
Entry
ROD_32291         CDS       T01145                                 
Symbol
amiB
Name
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_32291 (amiB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_32291 (amiB)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cro03036]
    ROD_32291 (amiB)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     ROD_32291 (amiB)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   ROD_32291 (amiB)
Chromosome and associated proteins [BR:cro03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ROD_32291 (amiB)
SSDB
Motif
Pfam: Amidase_3
Other DBs
NCBI-ProteinID: CBG89949
UniProt: D2TN06
LinkDB
Position
3409339..3410667
AA seq 442 aa
MIYRIRKWVVATLVLLCAQAGAASLSDIQVSNGDRQARITLSFIGEPDYAYSQSGKRTVA
LDIKQTGVIQGLPLQFSGNNLVKTIRSGTPKDPQSLRLLVDLTENGKTEAVKRQNGGNYT
VVFTINADVPPPPPQPPVVAKRVETPVVTPSRPAEPARNPFKSSNDRTTAVTSSNTVTRP
AARAAASSGDKIVIAIDAGHGGQDPGAIGPGGTREKNVTIAIARKLRTLLNADPMFKGVL
TRDGDYFISVMGRSDVARKQNANFLVSIHADAAPNRSATGASVWVLSNRRANSEMANWLE
EHEKQSELLGGAGDVLANSQSDPYLSQAVLDLQFGHSQRVGYDVATNMLGQLERIGSLHK
RRPEHASLGVLRSPDIPSVLVETGFISNHGEERLLASDEYQQRLAEAIYQGLRNYFQAHP
LQSAPEGTQTASAVTPGESLIN
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgatatatcgtatcaggaaatgggtggtggcaacgctggttctgctgtgcgcgcaggcc
ggtgccgccagcctctcagacattcaggtttctaatggcgatcggcaggcgcggatcacg
ctcagctttatcggcgagccggattatgcctattcgcagtccggaaaacgcaccgttgcg
ctggacattaagcaaaccggcgtaattcaggggctaccgttgcagtttagcggtaacaac
ctggtgaaaacgatacgttccggcaccccgaaagatccgcagtcgttacggctgctggtc
gatctcactgaaaacgggaaaactgaagcggtcaaacggcaaaacggcggtaattacacc
gttgtgtttaccattaacgccgacgttccgccgccgccaccgcaaccgcccgtggtggca
aagcgcgtggaaacgccggtcgtgacgccgtcgcgcccggccgaaccggcgcggaatccg
tttaaatccagtaacgatcgcaccacggcagtgaccagcagcaatactgtcacccgacct
gctgcgcgggcggcggccagcagcggcgacaaaattgtcatcgccattgacgccggccac
ggcggtcaggaccccggcgcaatcggccccggcggaacgcgtgaaaaaaatgtcactatc
gccatcgcccgcaaactgcgcactctgctcaatgccgatccgatgtttaaaggcgtgctg
acccgcgacggcgactactttatctccgttatggggcgttctgacgtggcgcgtaagcaa
aacgccaacttcctcgtctcgattcacgccgatgccgcgccgaaccggagcgcgaccggc
gcctcggtgtgggtgctgtcgaaccgtcgcgctaacagcgaaatggctaactggctggaa
gagcatgagaagcaatccgaactgctgggcggtgcgggcgacgtactggcgaacagtcag
tccgatccttacttaagccaggcggtgctggatttgcagttcggccattcccagcgtgta
gggtatgatgtggcgaccaatatgttaggccagctcgaacgcatcgggtcgctgcacaag
cggcgtccggaacacgccagcctgggcgtgctgcgttcgcccgatattccgtcggtgctg
gttgaaaccggcttcatcagcaatcatggcgaagaacgattgctggcgagcgatgaatat
cagcagcggctggccgaagcgatttaccagggactgcgtaactacttccaggcgcatccg
ctgcagtcggcgccggagggaacgcaaaccgcgagcgccgtcacgcccggcgagtcgttg
attaattaa

DBGET integrated database retrieval system