KEGG   Citrobacter rodentium: ROD_24991
Entry
ROD_24991         CDS       T01145                                 
Name
(GenBank) two-component system sensor kinase
  KO
K07711  two-component system, NtrC family, sensor histidine kinase GlrK [EC:2.7.13.3]
Organism
cro  Citrobacter rodentium
Pathway
cro02020  Two-component system
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_24991
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_24991
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cro01001]
    ROD_24991
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cro02022]
    ROD_24991
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ROD_24991
Protein kinases [BR:cro01001]
 Histidine kinases
  NtrC family
   ROD_24991
Two-component system [BR:cro02022]
 NtrC family
  GlrK-GlrR (amino sugar metabolism)
   ROD_24991
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 CHASE3 Clc-like
Other DBs
NCBI-ProteinID: CBG89242
UniProt: D2TU10
LinkDB
Position
complement(2633447..2634940)
AA seq 497 aa
MLYLAFPSVSIVPFFFFESNALKRWSVFPRSLRQLVMLAFLLILLPLLVLAWQAWQSLNA
LSAQAALTNRTTLIDARRSEAMTNVALEMERSYRQYCVLDDPTLAKVYQSQRLRYSEMLD
AHAGVLPDDKLYQALHQDLNDLAQLQCRNSGPDTAAAARLEAFASANTEMVQATRAVVFS
RGQQLQQEIAERGQFFGWQALALFLVSLAMVLLFTRMIIGPVKGIERMINRLGEGRSLGN
TVTFTGPRELRSVGQRIIWLSERLSWLESQRHQFLRHLSHELKTPLASMREGTELLADGV
VGPLTPEQKEVVGILDDSSRNLQKLIEQLLDYNRKLADSAVELESVEIAPLVDMVVSAHS
LPARAKMMHTEVALTAERCLAEPMLLMSVLDNLYSNAVHYGAESGNIRVCSRLQGTTVYI
DVINTGAPIPEAEKSMIFEPFFQGSQQRKGAVKGSGLGLSIARDCIRRMQGELYLVDERE
QEVCFRIELPLSASEND
NT seq 1494 nt   +upstreamnt  +downstreamnt
ttgttgtatctggcgtttccctcggttagcatcgttccattcttcttctttgagagtaac
gccttgaagcgctggtctgttttcccccgctcattacgccaactggtgatgctggcattc
ctgctgatcctgttgccgctgctggtcctcgcctggcaggcgtggcagagtctcaacgcc
ctgagcgcccaggcggcgctgaccaaccggacgacgcttatcgacgcccgtcgcagcgag
gcgatgaccaacgtggcgctggagatggagcgcagctaccgtcagtactgcgtgcttgac
gaccccacgctggcgaaggtgtatcagagccagcgtctgcgttacagcgagatgctcgac
gcccatgccggggtattgccggacgataagctgtaccaggcgttgcatcaggatctgaac
gatctggcgcaattgcagtgccgcaatagcgggccggataccgccgccgccgcgcggctg
gaggcgtttgccagcgccaataccgaaatggtgcaggcgacgcgcgccgtggtcttttcg
cgcgggcagcagcttcaacaggagattgccgagcgcgggcaattctttggctggcaggcg
ctggcgctgtttctggtcagcctcgcgatggtgctgctgtttacgcggatgattatcggg
ccggtaaaaggcattgagcgaatgatcaaccggctgggggaggggcgttcactcggcaat
actgtcaccttcaccggaccgcgggagctacgttccgtggggcagcgcattatctggctg
agcgagcgcctttcctggctggagtcccagcgccatcagtttttacgccacctctcccat
gagctgaaaacgccgctcgccagtatgcgcgaaggcaccgaactgctggccgatggggtc
gtcggtcctttaacgcctgaacaaaaagaggtggtcggcattcttgatgacagcagtcgc
aatctgcaaaaattgattgagcaactgctggattacaaccgcaagctggccgacagcgcc
gtcgagctggaaagcgtcgagattgcgccgttggtggatatggtggtgtccgcccacagt
ttacccgcccgcgctaaaatgatgcatactgaggtggcgctgaccgcagagcgctgtctg
gccgagccgatgctgctgatgagcgtactggacaatctttattccaatgcggtgcactat
ggcgctgaatccggtaacattcgtgtctgcagccgcttgcagggaaccacggtttatatc
gatgtcatcaataccggggcgcccatcccggaagcggaaaaatccatgattttcgagccc
tttttccagggaagccagcaacgaaaaggggcggtaaaaggcagcgggctggggctgagt
atcgcccgggattgcatccgccgtatgcagggggagctttaccttgtcgatgagcgggaa
caagaggtgtgcttccgtatcgaactgccattatctgcatcggaaaacgattaa

DBGET integrated database retrieval system