KEGG   Citrobacter rodentium: ROD_25601
Entry
ROD_25601         CDS       T01145                                 
Symbol
ffh
Name
(GenBank) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
cro  Citrobacter rodentium
Pathway
cro02024  Quorum sensing
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_25601 (ffh)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_25601 (ffh)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_25601 (ffh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_25601 (ffh)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     ROD_25601 (ffh)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_25601 (ffh)
  Eukaryotic Sec-SRP protein
   ROD_25601 (ffh)
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA Zeta_toxin AAA_30 AAA_31 cobW AAA_22 AAA_24 Helicase_RecD AAA_33 APS_kinase AIP3 AAA_16 KTI12
Other DBs
NCBI-ProteinID: CBG89303
UniProt: D2TUN4
LinkDB
Position
complement(2702920..2704281)
AA seq 453 aa
MFDNLTDRLSRTLRNISGRGRLTEDNVKETLREVRMALLEADVALPVVREFINRVKEKAV
GHEVNKSLTPGQEFVKIVRNELVAAMGEENQSLNLAAQPPAVVLMAGLQGAGKTTSVGKL
GKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAK
LKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEAL
PLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTDALEPFHPDRIASRILGMGDV
LSLIEDIESKVDRAQAEKLATKLKKGDGFDLTDFLEQLRQMKNMGGMASLMGKLPGMGQI
PDNVKSQMDDKVLVRMEAIINSMTLKERAKPEIIKGSRKRRIAQGCGMQVQDVNRLLKQF
DDMQRMMKKMKKGGMAKMMRSMKGMMPPGFPGR
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgtttgataatttaaccgatcgtttgtcgcgcacgctgcgcaacatcagtggccgtgga
cgccttactgaagacaacgttaaagagacgctgcgcgaagtgcgcatggcgctgctggag
gctgacgttgcgctgccggtagtgcgtgagtttatcaatcgcgtaaaagagaaagcggtt
ggccatgaagtaaacaaaagcctgacgccggggcaggagttcgtcaagattgtccgtaac
gaactcgtcgcggcgatgggtgaagaaaaccagagcctgaatctggcggcgcagccgccg
gccgtggtgctgatggcgggcctgcagggcgccggtaaaaccaccagcgtcggtaagctc
ggtaaattcctgcgtgagaagcacaagaagaaagtgctggtggtctctgccgacgtttat
cgcccggcggcgatcaaacagctggaaacgctggctgagcaggtgggcgttgatttcttc
ccgtctgatgtcggccagaagccggtggatattgtcaacgccgcgctgaaagaagcgaag
ctgaaattctacgacgtgctgctggtggataccgccggtcgtctgcacgttgacgaagcg
atgatggacgaaattaaacaggttcatgcttcgatcaatccggtagaaaccctgttcgtg
gtcgacgcgatgaccggtcaggatgcggcgaataccgcgaaggcgtttaacgaagcgctg
ccgctgaccggcgtggtgctgaccaaagtcgacggcgacgcccgcggcggtgccgcgctc
tctattcgtcacattaccggcaaaccgattaaattcctcggcgtcggcgagaaaaccgac
gcgctggagccgttccatccggatcgcatcgcctcgcgtattctcggcatgggtgacgtc
ctgtcgctgattgaagatatcgaaagcaaagttgaccgcgcccaggcggagaagctggcg
accaaactaaaaaaaggcgacggcttcgatctgaccgacttccttgagcagctgcgccag
atgaaaaacatgggcggcatggcaagcctgatgggcaaactgccgggcatgggccagatt
ccggacaacgttaagtcgcagatggacgataaagtgctggtgcgaatggaggcgatcatc
aactcaatgacgctgaaagagcgcgcgaagccggagattatcaaaggctcccgcaaacgc
cgtatcgcgcagggctgcgggatgcaggtgcaggacgttaaccgcctgttgaaacagttc
gacgacatgcagcgcatgatgaagaaaatgaagaagggcgggatggcgaagatgatgcgg
agtatgaaggggatgatgccgccaggcttccctggaagataa

DBGET integrated database retrieval system