KEGG   Citrobacter rodentium: ROD_27711
Entry
ROD_27711         CDS       T01145                                 
Symbol
cts1U
Name
(GenBank) T6SS protein Cts1U
  KO
K11892  type VI secretion system protein ImpK
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_27711 (cts1U)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_27711 (cts1U)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_27711 (cts1U)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: CBG89514
UniProt: D2THT1
LinkDB
Position
complement(2924258..2925613)
AA seq 451 aa
MKDDLNLQLSAEPAEDEGSSPQALGRFLLDEQGEWIQEPEATSKEETGPVGEHTARGEHA
LKSESVQQRILRVKAAENPLLEAAQPLLRALGDMPEQINDITHVEILKNTLKSQITLFGV
VCDEVNIPWKKMAIVRYCLCTALDEAAHTTAWGLEAGWSQSNLLNHFEGDNDGGNKFFLL
VGRLSMNPTEFADVLEVLLRILGLGFEGRYSIIEDGDRQLSKIRQRLLTLIQSTRNTTPP
ALSPHGLQPHGPAAREKLAIPVRLSALCAGVLVVSSFLWCKFWLLSRSDGITNDIYAMQN
FSVPVVQPAMRLKLAVLLRNEIRQQLLSVDENQKQSKVVLKGDALFLSGSVRVQPEMVKV
IERIASEVQRVNGDVLIVGHTDATPISRPGLPNNVALSEKRAAEVAQYFIAAGLPESKVK
VRGVGSSQPVANEATAQGRAKNRRVEFFVTY
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgaaagacgatcttaacctgcaactctccgcggaaccggcggaggatgaggggagttcg
ccgcaggcgttgggtaggttcctgctggatgaacagggggagtggatacaggagccggaa
gcgacgtcgaaagaggaaaccgggcctgttggcgagcatacggcgcgtggtgaacacgca
ctgaaaagcgaaagcgtgcagcagcggatcttacgcgtgaaggcggcggaaaatccgctg
ctggaagccgcgcaaccgctactgcgcgcgcttggcgatatgccggagcagattaacgat
attacccatgtcgaaatcctcaaaaacaccctcaaaagtcagatcacgctgttcggcgtt
gtctgtgacgaggtgaatattccgtggaaaaagatggcgatcgtgcgttattgcctctgt
accgcgcttgatgaggcggcgcataccacggcatgggggcttgaagcgggctggtcgcag
agtaacctgctgaaccactttgaaggagataacgacggagggaataaattctttctgctg
gttggccgtctctccatgaatcccactgaattcgcggatgtgctggaggtgttgctgcgc
attctggggctggggtttgaagggcgttacagcattattgaagatggcgaccgccagctc
agcaaaattcgccagcgtctgttgaccctgatccaaagcacgcgaaacaccacgccgccc
gcgctgtcgccgcatgggctgcaaccgcatggacctgcggcgcgcgagaagctggcgatc
cccgtgcggctaagcgcgctgtgcgctggcgtactggtggtgtcgtcgtttctctggtgc
aaattctggttactgtcgcgcagtgacggcatcactaatgacatctatgccatgcaaaac
ttcagcgtgcccgtggtgcaacctgccatgcgtctgaagctggcggtgctgctgcgtaac
gaaatcaggcagcagcttctcagcgtggatgagaaccagaagcagagcaaagtggtgctg
aaaggggatgcgttgttcctgtccggctctgtccgcgttcagccggagatggtgaaagtt
attgaacgtatcgccagcgaagtccaacgcgtgaacggcgacgtattgattgtcggccat
acggacgccaccccgatcagtcggccaggcctgcccaataacgttgcgctgtcggaaaaa
cgcgcggcggaagtggcgcaatattttattgcggccgggctgccggagagcaaagtgaaa
gtccgtggcgtggggagtagtcaacccgtggcgaacgaagcgacggctcagggaagggcg
aagaatcgccgtgtcgagttttttgtcacgtattaa

KEGG   Citrobacter rodentium: ROD_34141
Entry
ROD_34141         CDS       T01145                                 
Symbol
cts2U
Name
(GenBank) T6SS protein Cts2U
  KO
K11892  type VI secretion system protein ImpK
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_34141 (cts2U)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_34141 (cts2U)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_34141 (cts2U)
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: CBG90127
UniProt: D2TPU2
LinkDB
Position
complement(3595417..3596163)
AA seq 248 aa
MSVTPDMPACRLFDDLFSRWLAQFEQWKSAPLPPDELHRQAFDYSCQAVAEYSRRLSREL
GAPFRAHIDAAVYALVALIDETVLYGDWPALTFWQACPLEFHLWQTHCAGDRFPVCVQTL
LDERNPASRDLAALYLRCLTLGFGARRSDFNPLAHKETCRMLWHFAFQQDAEPGDIVTRL
DASSLGSPLLLPPRRRLPDNSRLHLIAVVVLLALLLLSQRLWLSIEDAIGVDTLPVFPVS
TFCGGEKS
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtcggtcacgcctgatatgcccgcctgccgtctgttcgacgacctattttcccgctgg
ctggcgcagttcgaacagtggaaaagtgcccctctgccccccgacgaactgcatcgccag
gcgtttgattacagctgtcaggcggtagcggaatatagtcgacgcctgtcccgggaactg
ggcgcgccgtttcgcgcgcacattgacgccgcggtttatgcgctggtggcgctgattgac
gaaaccgttctttacggcgactggcccgccctgacgttctggcaggcgtgcccgctggaa
tttcacctgtggcagacccactgcgcgggcgatcgttttccggtatgcgtacagactctg
ctcgacgaacgtaatccggccagccgcgatctggcggcgctttacctgcgctgcctgacg
cttggcttcggcgccagacgcagcgattttaatccgctggcgcataaggaaacctgccgg
atgctctggcatttcgccttccagcaggatgccgagcctggcgacatcgtgacgcgtctt
gacgccagttcgctggggtcgccgctgctgcttccgccccgtcgacgtctgccggacaac
tcgcgcctgcacctgatcgccgtcgttgtgctgctggcgctgctgctgttaagtcaacgt
ttgtggctgagtattgaagatgccattggcgtcgacacgttaccggtcttcccggtcagc
acgttctgcggaggcgaaaaatcatga

DBGET integrated database retrieval system