KEGG   Citrobacter rodentium: ROD_27811
Entry
ROD_27811         CDS       T01145                                 
Symbol
cts1V
Name
(GenBank) T6SS protein Cts1V
  KO
K11907  type VI secretion system protein VasG
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_27811 (cts1V)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_27811 (cts1V)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_27811 (cts1V)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Sigma54_activat AAA_22 AAA_7 AAA_25 NACHT TniB AAA_14 IstB_IS21 Zeta_toxin T2SSE AAA_24 AAA_29 TsaE SRP54 AAA_30 RuvB_N Clp_N
Other DBs
NCBI-ProteinID: CBG89524
UniProt: D2THU1
LinkDB
Position
complement(2934994..2937696)
AA seq 900 aa
MSLVVAITRKNLFGKLNISLFKSVESATTLCKLRGNPYVELVHWLNQIYQQQDSDIRHIV
RHFELDAEILERDFAQALTRLPAGASSISDFSYHIELAIERAWIFASLECQNTSIRSGHL
LMALLTTMELRRALFSISSVFEKIPLEQLSKDLGYIIRDSAEESEAGGAMVSAEAGVPGE
ASNAMGGTQSGGLAQYSTDLTALAREGKIDPVLGRDKEINTMIDILLRRRQNNPLLTGEA
GVGKTAVVEGLALALAAGEVPPALQKVRLLTLDVTALSAGASMKGEFEARLKAVLEDAAK
SVDPVILFIDEVHTLVGAGGNAGTGDAANLMKPMLARGQLRTIGATTWSEFKRHIEKDPA
LTRRFQVLQVEEPSEDLAIAMLRGLLPVLEKHHGVWVMDEAIRAAVRLSHRYIPARQLPD
KAISLLDTACARVAVAQHAPPTELQLLKFHQQSAQAELSMLEKAIGFGKEDDKRLQPIQR
AIDDHAEEATALERRWAQECELVATIIDTRQQLLAATVDDPQTPEAEKISYLQSRLNELE
ATLSEIRGEKALVQTEVNASIVAAIVADWTGIPVGQVLKDDVSAVMELPQRLAEKVIGQT
YALTCLSQSIQTARAGLADPQKPFGVFMLVGPSGVGKTETALAIADQLYGGKQNLITINM
SEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEVEKAHTDVHELFFQVF
DKGSMEDGEGRQIDFRNTVILLTSNAGSDIISSACADPQTMPDEEGLLKLLQPALLKIFP
AAFLGRVTVIPYLPLATDSLQHIVRIHLNRIAERAKAQYEMTLNFSDELVQHVVEQCPVA
ETGARMLIRFIEKNILPKIGSALLTQADKPAKNKTITMQCILSEEKEIDIEMQLEGKQNI
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgagtcttgttgtggcgattaccagaaaaaatctattcggaaaacttaatataagcctg
tttaaaagcgtggagagtgccactacgctgtgtaaattacgcggtaatccttacgttgaa
ttggttcactggttaaatcagatttatcagcagcaggatagcgatatccgccatattgta
cggcattttgaacttgatgcagaaattctcgaacgtgattttgctcaggcattaacgcgc
ctgccggcgggcgccagttctatttccgatttttcatatcatattgaactggctatcgag
cgggcatggatatttgccagcctggagtgtcagaacacgagtattcgtagcggtcatttg
ttgatggcgctgctgaccaccatggaattacgtcgcgcgctattcagcatttcgtctgta
ttcgaaaaaattccgctggaacagttaagcaaagatcttggctacattattcgcgactct
gcggaagagagcgaagcgggcggcgcaatggtttccgccgaagcgggcgtaccgggcgaa
gccagtaacgcgatggggggcacgcagagcggcggactggcgcaatattcaaccgatctg
accgcgctggcgcgtgaaggcaaaattgatccggtgctggggcgggataaagagatcaat
accatgatcgatattctgttgcgtcgtcgacagaataacccgctgctcaccggggaagcg
ggggtcgggaaaacggcggtcgtggaaggtctggcgctggcgttagctgccggagaagta
ccgcccgcgctgcaaaaagttcgcctgctgacgctggatgtcaccgcgctttccgccgga
gccagcatgaaaggtgaatttgaagcgcgtttaaaagcggtgctggaagacgccgccaaa
tcagtcgatccggtgattttgtttattgatgaggtgcatacgctggtcggcgcgggcggc
aatgccggcaccggggatgccgctaatctgatgaaaccgatgctggctcgcgggcagctg
cgcaccatcggtgcgacaacctggagcgaatttaagcgccacatcgaaaaagatccggcg
ctgacgcgacgtttccaggtgctgcaggtcgaggagccgtcggaagatctggctatcgct
atgctgcgcggcctgctgccggtactggaaaaacaccacggcgtctgggtcatggatgag
gcgatccgcgccgccgtccgtttatctcatcgctatattccggcccggcagttgcccgat
aaagcgatcagcctgctggatacggcctgcgccagggtcgccgtcgcgcagcacgcgccg
ccaaccgagctacagctgctgaaattccatcagcagtcggcgcaggctgaactgtccatg
ctggaaaaagcgattggctttggcaaagaggacgataaacgccttcagccgattcagcgc
gctatcgacgaccatgcagaagaagcgacggcgctggagcggcgctgggcgcaggagtgc
gaactggtggcgacgattattgatacccgccagcagttgcttgccgccacggtggacgat
ccgcaaacgccggaagcggaaaaaatcagttacctgcagtctcgtttgaatgagctggaa
gcgacgctgagcgagatccgcggcgaaaaggcgctggtgcagacggaagtgaacgccagc
atcgtggcggcgatcgtggcggactggacgggtatcccggtgggtcaggtgctgaaagac
gacgtcagcgccgtcatggaactaccgcaacgtctggcggaaaaagtcattggccagacg
tatgcgttaacctgcctgagccagagtattcagaccgcgcgcgccgggcttgccgatccg
caaaaaccttttggcgtgttcatgctggttggcccttccggggtcgggaaaaccgaaacc
gcgctggcgattgccgaccagctttatggcggcaagcagaatctgatcactattaatatg
agtgaatatcaggaagcgcatacggtttcttcgctgaaaggatcgccgccgggttatgtg
ggatatggcgaaggcggcgtattaaccgaagcggtacgccgcaagccttatagcgtcatt
ttactggatgaagtggaaaaagcgcacaccgatgtgcatgaactgtttttccaggtattt
gataaaggttcgatggaagacggtgaagggcggcagatcgattttcgcaataccgtcatt
ttgctgaccagtaacgccggtagcgacattattagcagcgcctgcgccgatccgcaaacc
atgcctgatgaagaaggcttgctgaaattactacagccagcattgctgaagatatttccg
gccgcgtttttaggtcgcgtcaccgttataccttatttaccgttggcgacggattcgctg
cagcatattgtcagaattcatttgaaccgtatcgctgagcgtgcgaaagcgcagtatgag
atgacgcttaacttcagcgatgaattggtccagcacgttgttgaacagtgtccggtagcg
gaaaccggcgccaggatgctaatccgctttattgagaaaaatattttaccaaagataggc
agtgcacttttaacccaggctgacaaaccggcaaaaaataaaacaataaccatgcagtgc
attttatctgaagaaaaggaaattgatattgagatgcaactggagggaaaacaaaacatt
taa

KEGG   Citrobacter rodentium: ROD_34231
Entry
ROD_34231         CDS       T01145                                 
Symbol
cts2V
Name
(GenBank) T6SS protein Cts2V
  KO
K11907  type VI secretion system protein VasG
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_34231 (cts2V)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_34231 (cts2V)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_34231 (cts2V)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 Clp_N AAA_22 AAA_16 T2SSE Zeta_toxin AAA_25 ResIII Sigma54_activat AAA_7 IstB_IS21 AAA_14 TniB AAA_18 AAA_23 SRP54 NACHT Torsin IPT ClpB_D2-small
Other DBs
NCBI-ProteinID: CBG90136
UniProt: D2TPV1
LinkDB
Position
3603847..3606354
AA seq 835 aa
MDLKALVQRLNPVCLYALEQAAGRSRAQGHWFVEPEHLLLALLDDEHCDLACCLDGAGIP
VDALRDEIRRAQSQFRTGCTRMPVFSAQLVELLEGALLLTTFRQLKQVRSALLLLTLLTR
DRLRAQLAQGLPLLLKISAEQLEDHWLNWCRGSAEAVSDRSDADAAVRGDSVLDQYTHDL
TREARQGRIDPIIGRDAEIRQCIDILLRRRQNNPILVGAPGVGKTAVAEGLALRIAEGSV
PPPLRDVALLSLDLGLLQAGAGVKGEFEQRLKGVIEAVKKSSQPIVLFIDEAHTLIGAGG
AEGGSDAANLLKPALARGELRTIAATTWQEYKKYFEKDPALDRRFQRIHIEEPDEDSAVM
MLRAVADKLEAHHGVQILDTAIREAVRLSQRYISGRQLPDKAISVLDTACSRVALAQHDI
PPALEEVRQQLATIEEESVRLNRELLVGIDHHDRLCDLEAQAKLLQLQAQEVEERWQDER
QRVGELLAARQRMLALNARLDDEEELEQELVECAALIGKLETAAVQLRDEVPLVPDCVDA
ATVAAVIGGWTGIPIGQMLTDEAHALRTLVERMSERVMGQRAALETIARRLRAYRSGLTD
PQKPVGVFLLVGPTGVGKTETAYALADALYGGERNLITINLSEYQEAHTVSQLKGAPPGY
VGYGSGGALTEAVRRRPYSVVLLDEIEKAHPDVLEAFYNVFDKGVMEDGTGLIVDFKNTV
MLATSNVGAELILETPTSEFNSEWFNTAMREELLRHFRPAFLARMTTVAYRALDEETLKG
IVLAKLEKLAQRYLVATGEKLNMEDGLVERVMDQCKGVGARDIENLVIGAVMGDK
NT seq 2508 nt   +upstreamnt  +downstreamnt
atggacttaaaagcgctggtacagcggctgaacccggtttgtctgtacgcgctggaacag
gccgccgggcgtagccgggcgcaggggcactggtttgtggagccggaacatctgctgctg
gcattgctggacgacgagcactgcgatctggcgtgctgccttgacggcgcggggattcct
gtcgacgcgctgcgcgatgagatccggcgcgcccagtcgcagttcagaaccggctgtacg
cgaatgccggtcttttctgcgcagttggtggagctgctggagggggcgctgttactgacc
actttccgtcagttgaagcaggtgcgctccgcgctgctgctgctgactctgctcacccgc
gatcgcctgcgcgcccagttggcgcaggggctaccgctgctgttaaagatctccgcagaa
caactggaagatcattggctgaattggtgtcgtggatccgctgaagcggtgagcgataga
tcggacgctgacgcggcggttcgcggcgacagcgtgctggatcaatacacacacgatctt
acccgtgaagcccggcaaggacggatcgacccgatcatcgggcgtgatgctgaaatccgt
cagtgcattgacattctgctgcgccgtcggcagaacaacccgattctggtaggcgcgccg
ggcgtcgggaaaaccgccgtcgccgaagggctggcgctgcgtatcgccgaaggcagcgtg
ccgccgcctctgcgtgatgtggcgctgctttcactcgatctcggcctgttacaggcgggg
gcgggagtgaaaggcgaatttgagcagcgcctgaaaggggtgattgaggcggtcaaaaaa
tcctctcagccgatcgtcttgtttatcgacgaagcccatacgctgattggcgcaggcggc
gccgagggcggcagcgatgccgccaacctgctgaagccagcgctggcgcgtggcgagctg
cgaaccattgccgctaccacctggcaggagtacaaaaaatattttgagaaggacccggcg
ctggatcgccgttttcagcgcattcatattgaagagccggacgaggatagcgcggtgatg
atgctgcgggcggtggccgataagctggaagcgcaccacggggtgcagattctggatacc
gctattcgagaggcggtgcgcctgtcgcaacgctacatctccgggcgtcagctaccggat
aaggctatcagcgtccttgataccgcctgttcgcgggtggcgctggcgcagcatgatatc
cctccggcgttggaggaggttcgccagcagctggctaccattgaggaagagagcgtgcgt
ctgaatcgcgagctgctggtgggcatcgatcatcacgatcggctatgcgatctggaggcg
caggcgaagctgttgcagcttcaggcgcaggaggtggaggaacgctggcaggatgaacgc
cagcgggtcggcgaactgctggctgcccgtcaacggatgctggcgctgaacgcgcggctg
gacgacgaggaagaactggaacaggagctggtggagtgcgcggcactgatcggcaaactg
gaaaccgccgccgtccaactccgcgatgaagtgccgctggtaccagactgcgttgatgcc
gccaccgttgcagcagtgatcggcggctggaccgggataccgatcgggcagatgcttact
gatgaagcgcacgcgctgcgtacgctggtcgaacggatgagcgagcgggtgatggggcaa
cgggcagcgcttgagactatcgcccggcggctgcgcgcctaccgcagcggcctgaccgat
ccgcaaaagccggttggcgtattcctgctggtggggccaaccggcgttggcaaaactgaa
accgcctatgcgctggccgatgcgctctacggcggcgaacgaaatctcatcaccatcaac
ctctccgaataccaggaagcgcacaccgtcagccagttaaaaggcgcgccgccgggttac
gtcggctatggcagcggtggggcgctaactgaagccgtgcgccgccgtccttactctgtg
gttctgctggatgaaatcgaaaaggcgcatccggacgtgctggaggcgttttataacgtc
ttcgacaaaggcgtcatggaggacggtaccggattaattgtcgacttcaaaaacacggtg
atgctggcgaccagcaacgtcggggcggagttaattcttgaaacgccgacttctgaattc
aatagcgagtggtttaatacggcgatgcgcgaagagttgttgcgccattttcgtccggcg
tttttagcgaggatgaccacagtagcctatcgcgcgttggatgaagaaacattaaaaggc
attgtgctggcgaaactggagaaattagctcaacggtatctggtggcgacaggtgagaaa
ttaaatatggaggatgggctggtcgaaagggtaatggatcaatgtaagggagtgggggcc
agagatattgagaatctggtgattggggcagtaatgggcgataaataa

DBGET integrated database retrieval system