KEGG   Citrobacter rodentium: ROD_29871
Entry
ROD_29871         CDS       T01145                                 

Symbol
map
Name
(GenBank) T3SS effector protein Map
  KO
K12787  LEE-encoded effector Map
Organism
cro  Citrobacter rodentium
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
SSDB
Motif
Pfam: IpaB_EvcA LacI ORF6C
Other DBs
NCBI-ProteinID: CBG89719
UniProt: D2TKE9
LinkDB
Position
complement(3161144..3161755)
AA seq 203 aa
MFNPTAMVGRALAQAATQTLRPVVTKAATQAGMGASGMRFVPVQSNLMINHDKLTAQLLK
AVAKQTGNGDTQQWFRQEQITFISKTVNKTVDDYCINNNSTINKETKQHIFKAVESVIQQ
PLDINCAQSSISHFLQSNKYFNKIVDEQCGKGVDPITRFNTQTKMIDDVSCELFEKNFNS
TKVSDIKAITQSVIADCVQDTRL
NT seq 612 nt   +upstreamnt  +downstreamnt
atgtttaatccaacggcaatggtcggtagagcgttagctcaggcggctacacaaactctt
agaccagtggtaacaaaggctgcaacacaagcgggcatgggagccagcggtatgaggttc
gtacctgtgcagtcgaaccttatgattaatcatgacaaactgactgctcagctactaaag
gccgtggccaaacaaactggtaatggtgatactcagcaatggttccggcaggagcagatt
acttttatatccaaaacggtaaacaaaactgtggatgactattgcataaataataattcg
acaattaataaggagactaaacagcacatttttaaagcggttgaaagcgtgatacagcag
cctcttgatataaattgtgcacaatcatcaatcagtcactttttgcaatctaataaatat
tttaataagatagttgatgagcagtgcggtaaaggagtggatcctattacacgttttaac
actcagactaagatgatagacgatgtctcatgcgaactgtttgaaaagaattttaactcc
acgaaagtgagcgatatcaaagctataacgcagagtgtgattgcagattgtgtgcaggat
accaggctgtag

DBGET integrated database retrieval system