KEGG   Citrobacter rodentium: ROD_30081
Entry
ROD_30081         CDS       T01145                                 
Symbol
escU
Name
(GenBank) T3SS structural protein EscU
  KO
K03229  type III secretion protein U
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_30081 (escU)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_30081 (escU)
Secretion system [BR:cro02044]
 Type III secretion system
  Type III secretion core apparatus
   ROD_30081 (escU)
SSDB
Motif
Pfam: Bac_export_2
Other DBs
NCBI-ProteinID: CBG89738
UniProt: D2TKG7
LinkDB
Position
complement(3175324..3176361)
AA seq 345 aa
MSEKTEKPTPKKIRDLKKKGDVTKSEEVMAAVQSLILFSFFSLYGASFFIEVAGVVNTTI
NSLNEPFLYSIHEILGAVLKIFLLYVLPIVLFVFVGTVATGVSQIGFIFAVEKIKPSAQK
ISIKNNLKNIFSVKSIFELLKSVFKLVIISLIFYFMGNTYASEFVNFTRLNAYQTLVIIA
FFIFLLWKGVLFGYLLFSVFDFWFQKHEGLKKMKMSKDEVKREAKDTDGNPEIKGERRRL
HSEIQSGSLANNIKKSTVIVKNPTHIAVCLYYKLGETPLPLVIETAKDAKALQIIKLAEL
YNIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAMDIDY
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgagtgaaaaaacagaaaagcctacacctaaaaaaattagggatttaaaaaagaagggc
gatgtaactaaaagtgaagaggtaatggctgctgtgcagtcgttaatcctattttcattt
ttttctttatatggcgcaagtttttttattgaggttgcaggagtagttaatacaactata
aactcgcttaatgaaccatttttatattccatacacgaaatattaggagctgtgttaaaa
atatttttattatatgttttaccaattgttctttttgtgtttgtaggtactgttgcgacc
ggtgtatcacaaataggattcatctttgcggtggaaaaaataaagccatcagctcagaag
attagtataaaaaacaacctaaaaaatattttttcagtgaagagtatttttgaattactt
aaatcagtatttaagttggtgattatctctctaattttttactttatgggaaatacatat
gcgagtgaatttgttaattttacaagactaaatgcctatcagactcttgttattatcgct
ttttttatttttcttttatggaaaggtgtgttattcggatatttgctcttttcggtgttt
gatttttggttccagaaacatgagggattgaaaaaaatgaaaatgagtaaagatgaggtg
aaacgagaagccaaagatactgatggtaaccctgaaattaaaggcgaacgcaggcgtctt
cattccgagatacaaagtggaagtctggctaataacatcaaaaaatcaactgttattgtc
aaaaatccgactcatattgcagtctgtctgtactacaaacttggtgagaccccattacct
ttagtgattgaaacagcaaaagatgccaaagcactacaaatcattaaacttgcggaatta
tataatattccagtgattgaagatattccattggcaagaagcctctataagaacatacat
aaagggcaatatataacagaagacttttttgaacctgttgcacaattgatccgtattgca
atggatattgattattaa

DBGET integrated database retrieval system