KEGG   Citrobacter rodentium: ROD_31791
Entry
ROD_31791         CDS       T01145                                 
Symbol
espM3
Name
(GenBank) T3SS effector protein EspM3
  KO
K23653  T3SS effector EspM
Organism
cro  Citrobacter rodentium
SSDB
Motif
Pfam: IpaB_EvcA DUF4318 TMEM43
Other DBs
NCBI-ProteinID: CBG89902
UniProt: D2TM85
LinkDB
Position
3339803..3340381
AA seq 192 aa
MPVNVQGLSFNSFGISCHQKKSFWGECDEVVKCSMGQRRISFSVQKVSDNILSLVTRQST
KDIDGWIKDEQKVYPSRVVNQEIDKFCLENRRNITNNDRKRVFAIISKHYGLELDSGAAQ
SSINHMIIGNGSFGKKMDNLCEGMTRNVKNHTSDYMANLLADKFYEKHIEPDVDITRLRG
MIPRYMRYAISL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgccagtgaatgttcaaggtttatcttttaattcttttggtatcagctgccatcagaaa
aaatccttctggggtgagtgtgatgaagttgtaaaatgctcaatgggacaaaggcgcatc
agcttttctgttcaaaaagttagcgataacatactgagtttggtaacccggcagagtact
aaagatattgatggatggataaaagatgaacagaaagtgtatccatcaagggtggtgaat
caggaaatcgataagttctgccttgaaaataggcgtaacatcactaacaatgacagaaaa
agagttttcgctattatttcaaagcattatggcctggaacttgattctggagcagctcaa
agctccatcaatcatatgataataggaaatggttcttttggtaaaaaaatggataacctt
tgcgaggggatgaccaggaatgtaaaaaatcatacatcagattacatggccaacttgctt
gcagacaagttttatgagaaacatatcgaaccggatgttgatattacaagattaaggggt
atgattcctcgttatatgaggtatgctatatcgctgtaa

DBGET integrated database retrieval system