KEGG   Citrobacter rodentium: ROD_35051
Entry
ROD_35051         CDS       T01145                                 
Name
(GenBank) putative thiol:disulfide interchange protein
  KO
K03673  protein dithiol oxidoreductase (disulfide-forming) [EC:1.8.4.15]
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_35051
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cro03110]
    ROD_35051
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.15  protein dithiol oxidoreductase (disulfide-forming)
     ROD_35051
Chaperones and folding catalysts [BR:cro03110]
 Protein folding catalysts
  Protein disulfide isomerase
   ROD_35051
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_5
Other DBs
NCBI-ProteinID: CBG90218
UniProt: D2TQT2
LinkDB
Position
3700178..3700849
AA seq 223 aa
MATHFKRITIISYSLFLIVISSLMTVLCYHIFVFKTFAADDGQTQAFREVSAEYVANSPI
KEQRSIVEVMSYGCHYCAANEDNLAEFARSLPPGSTFTSIHIAGNDSGLAAWAPIFATLE
EMGIEKTVRDSAYNAVITRNVNLADEKTLADWLAKNNIDTAKFNALRQSDAVKKRLSEMA
AITTHYNINATPIFIINKRYVVAQDRDFPQFAERMLQLLKEER
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcgactcactttaaacgcattacgattattagctattcgctgtttctgatcgttatc
tcttcgctgatgacggtgctttgttaccatatttttgtgtttaaaacctttgccgcggat
gacgggcagacgcaggcattccgtgaagtcagcgcagagtatgtcgcgaacagcccaatc
aaagaacaacgcagtatcgttgaggtgatgtcttacggttgccattattgcgcagccaat
gaggataatctggccgaatttgcccgttcattgccaccgggcagtacatttacctccatt
catattgccggaaacgatagcgggcttgctgcctgggcgccgatattcgccactctggaa
gagatggggattgaaaaaacggtacgcgacagcgcctataacgcggttattacccgtaat
gtcaacctggccgatgaaaaaacgctggccgactggctggcgaaaaataatatcgacacg
gcgaaatttaacgcgcttcgccagagtgacgcggtgaaaaaacggctcagcgagatggcg
gccattaccacccactataatattaacgccaccccgatatttattattaataagcgctat
gtcgtcgcccaggaccgcgactttccgcaatttgccgagcgtatgctgcaactgctgaaa
gaggaacggtaa

KEGG   Citrobacter rodentium: ROD_38991
Entry
ROD_38991         CDS       T01145                                 
Symbol
dsbA
Name
(GenBank) thiol:disulfide interchange protein
  KO
K03673  protein dithiol oxidoreductase (disulfide-forming) [EC:1.8.4.15]
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_38991 (dsbA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cro03110]
    ROD_38991 (dsbA)
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.15  protein dithiol oxidoreductase (disulfide-forming)
     ROD_38991 (dsbA)
Chaperones and folding catalysts [BR:cro03110]
 Protein folding catalysts
  Protein disulfide isomerase
   ROD_38991 (dsbA)
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin DUF3088 Lpp-LpqN DUF3787 Thioredoxin_2
Other DBs
NCBI-ProteinID: CBG90603
UniProt: D2TUX9
LinkDB
Position
complement(4115018..4115641)
AA seq 207 aa
MKKIWLALAGMVLAFSASAAQFEDGKQYTTLEKPVAGEPQVLEFFSFYCPHCYQFEEVLH
VSDNVRKKLPEGVKMTKYHVEFLGPLGKEMTQAWAVAMALGVEDKVTVPMFEGVQKTQTI
QSVADIRKVFVDAGVKGEEYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMFVNGKYQVN
PQGMDTSSMDIFVQQYADTVKYLVSKK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaagaagatttggctggcgctggctggtatggttttagcttttagcgcatcggcagcg
cagttcgaggatggcaaacagtacaccaccctggaaaagcccgttgccggtgaaccgcag
gtgctggaatttttctctttctattgcccacactgctatcagtttgaagaagttcttcat
gtttctgacaacgtgaggaaaaaactgccggaaggcgtcaaaatgaccaaatatcacgtc
gaattcctcggaccgttgggcaaggagatgacgcaggcctgggcagtggcgatggcgctg
ggcgtcgaagataaagtgaccgtaccgatgtttgaaggggtacagaaaacccagactatc
cagagcgtggcggatattcgtaaagtgttcgttgacgcaggcgtcaaaggtgaagaatac
gacgcggcgtggaacagctttgtggtgaaatcgctggtcgcccagcaggagaaagcggct
gccgacctgcaactgcagggtgtgccggcgatgtttgttaacggcaaatatcaggtgaat
ccgcagggcatggataccagcagtatggatatctttgttcagcagtatgcggataccgtg
aaatatctggtcagcaaaaaataa

DBGET integrated database retrieval system