KEGG   Citrobacter rodentium: ROD_38381
Entry
ROD_38381         CDS       T01145                                 
Symbol
cpxR
Name
(GenBank) two-component response regulator
  KO
K07662  two-component system, OmpR family, response regulator CpxR
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_38381 (cpxR)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_38381 (cpxR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cro02022]
    ROD_38381 (cpxR)
Two-component system [BR:cro02022]
 OmpR family
  CpxA-CpxR (envelope stress response)
   ROD_38381 (cpxR)
SSDB
Motif
Pfam: Response_reg Trans_reg_C FleQ
Other DBs
NCBI-ProteinID: CBG90542
UniProt: D2TU76
LinkDB
Position
4044541..4045239
AA seq 232 aa
MNKILLVDDDRELTSLLKELLEMEGFNVLVAHDGEQALELLDDSIDLLLLDVMMPKKNGI
DTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHW
SEQQQSSDNSSPTLEVDALSLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREH
LSQEVLGKRLTPFDRAIDMHISNLRRKLPERKDGHPWFKTLRGRGYLMVSAS
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaataaaatcctgttagttgatgatgaccgagagttgacatcccttttaaaggaactg
ctggaaatggaaggcttcaacgtgctggttgcccatgacggggaacaggcgctggagctt
ctggacgacagcatcgatttacttttgcttgatgtcatgatgccgaagaaaaacggcatt
gataccctgaaagcgcttcgccagacacaccagacccccgttattatgctgaccgcccgc
ggcagcgaactggatcgcgtgcttgggcttgaactgggcgcagatgactatttaccgaag
ccgtttaacgatcgcgaactggtggcgcgtatccgcgcgatcctccgccgctcgcactgg
agcgaacagcagcagagcagcgataacagctcgccgacgctggaagtggacgcgctcagc
ctcaatccggggcgtcaggaagccagctttgacgggcagacgctggagctcaccggcacc
gagttcacgctgctttatttgctggcgcagcatctcggtcaggtggtatcgcgtgaacat
ctcagccaggaagtgctgggcaaacgtctgacgccttttgaccgcgccatcgatatgcat
atctcgaacctgcgtcgcaaactgccggagcgcaaagatggccacccgtggtttaaaact
ctgcgtggtcgcggctatctgatggtttccgcttcatga

DBGET integrated database retrieval system