KEGG   Citrobacter rodentium: ROD_44901
Entry
ROD_44901         CDS       T01145                                 
Symbol
gspK
Name
(GenBank) putative T2SS protein K
  KO
K02460  general secretion pathway protein K
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_44901 (gspK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_44901 (gspK)
Secretion system [BR:cro02044]
 Type II secretion system
  General secretion pathway protein
   ROD_44901 (gspK)
SSDB
Motif
Pfam: T2SSK
Other DBs
NCBI-ProteinID: CBG91185
UniProt: D2TMH1
LinkDB
Position
complement(4746621..4747586)
AA seq 321 aa
MQNERGSALLVTLLMLALMAALAAELTIGFQTQLQRSRRVNASLQTKFALLYAEKRAINT
LQTAVLAPLHEQPDSEDLGEETTVSWRAQDQQRCFNLNALANAPEEPLAEPPYEVKVFSA
LLEKSNVDGARAEEIIQSLADDIDTNNTPRLRGAEDEYYQRKSGKGFAANQLLLTVDEAR
QVKGMTEAIFQRLSPFICTQFSNALSVNVNALTERDAPLLAALFLNEISDSDAKALLRKR
PEEGWQNVDAFLYQAQKEYSATKTLVDALKKMIGVQSQYFRVDATARHGEFTVGMRSWLY
YDEKNKTLRTWLRQLTAGDEE
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcaaaatgagcgcggatcggccctgctggtgacgttattaatgctggcgctaatggcc
gcgctggcggctgagctaaccatcggctttcagacacagttgcagcgtagccgccgggtc
aatgccagtctgcagacgaaattcgccctgctctatgcggagaaacgggccatcaacacc
ctgcaaacagcggtgctggccccattacatgaacagccggacagcgaagatcttggcgaa
gaaacaacggtatcctggcgcgcgcaggaccagcagcgctgctttaacctcaatgcgctg
gcgaacgctcccgaggagccgctcgccgagccgccgtatgaggtaaaagtcttctccgcc
ttactggaaaaaagcaacgtggacggcgcgcgggcggaagagattattcagtctctggcg
gatgacattgacaccaataataccccacgcctgcgcggagcagaggacgagtattatcag
cgcaaaagcgggaaagggtttgccgctaaccagctgttgctcaccgtcgacgaggcgcgt
caggttaaaggtatgacggaagccatttttcagcgtttgtcgccgtttatctgcacacag
ttcagtaacgcgctttccgtcaatgtgaatgctctgacggagcgggatgccccgcttctg
gctgcgctttttctcaatgagatcagcgatagcgacgcaaaagcgctgttgcgcaagcgt
ccggaggaaggctggcagaacgtcgatgcatttttatatcaggcgcaaaaagagtattcc
gccaccaaaacgctggtggatgcgctcaaaaaaatgatcggtgttcaaagccagtatttc
cgggtcgacgcgaccgcccgacacggtgaattcacggtgggaatgcgcagttggctctac
tacgacgaaaaaaacaagacgctcaggacctggttacgccagttaacggcaggtgacgaa
gaataa

DBGET integrated database retrieval system