KEGG   Citrobacter rodentium: ROD_44911
Entry
ROD_44911         CDS       T01145                                 
Symbol
gspJ
Name
(GenBank) putative T2SS protein J
  KO
K02459  general secretion pathway protein J
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_44911 (gspJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_44911 (gspJ)
Secretion system [BR:cro02044]
 Type II secretion system
  General secretion pathway protein
   ROD_44911 (gspJ)
SSDB
Motif
Pfam: T2SSJ N_methyl
Other DBs
NCBI-ProteinID: CBG91186
UniProt: D2TMH2
LinkDB
Position
complement(4747576..4748163)
AA seq 195 aa
MTHKQSGFTLLEVMLAIAILASLSLLAVTVFSQAIEHYQRAQTLMQSFNALQRTDLLLSN
DLMQLVPRKNRQTGQVFQTETDGMIFSTQSLSVDNLAQPRPVLITVHWYLKDGVVYRALR
AAPDDKKELTPRPVLSDVTRFTARLDRTEDGSAPAQATVTLEFTSGETVQRRYVLPDWFP
QPQQASESPEKNNAK
NT seq 588 nt   +upstreamnt  +downstreamnt
atgacgcataaacagagcggttttaccctgcttgaggtgatgctcgccatcgccattctt
gcatcgctgagcctgctggcggtaaccgtgttttctcaggccattgaacattaccagcgc
gcgcaaacgctgatgcaaagtttcaatgccctgcaacgaaccgatctgttgctaagtaac
gatttaatgcagcttgtgccgaggaaaaaccgccagaccggtcaggtatttcaaacagaa
accgacggcatgattttttcaacccaatcgctgagcgttgacaaccttgcgcagccgcgc
ccggtgttgattaccgtccactggtatttaaaggatggagttgtgtatcgcgcccttcgc
gcagcgccggatgataaaaaagagctaactccgcgtccggtgttgagcgatgtgacccgt
tttaccgccagactggacagaacggaagacggcagcgcgccggcgcaggcgacggtaacg
cttgagtttacgtccggagaaacagtgcaacggcgctatgtgctgccggactggtttccg
caacctcagcaggccagtgaatccccggagaagaacaatgcaaaatga

DBGET integrated database retrieval system