KEGG   Citrobacter rodentium: ROD_44921
Entry
ROD_44921         CDS       T01145                                 
Symbol
gspI
Name
(GenBank) putative T2SS protein I
  KO
K02458  general secretion pathway protein I
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_44921 (gspI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_44921 (gspI)
Secretion system [BR:cro02044]
 Type II secretion system
  General secretion pathway protein
   ROD_44921 (gspI)
SSDB
Motif
Pfam: T2SSI N_methyl DUF3108 Lipase3_N PulG
Other DBs
NCBI-ProteinID: CBG91187
UniProt: D2TMH3
LinkDB
Position
complement(4748160..4748513)
AA seq 117 aa
MKTQQSGMLLLEVLVAMAILATAILALLISMQWQFRAIRTIQQETLALWSADNALIVARG
GKLKASEGNERQRDLSFRWQLTATTRSSQTERQQIVVSGPDDTMSSLSAWLPVEPAE
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaaaactcagcaaagcggcatgctgctgctggaagtgttggtagcaatggctatttta
gctaccgccattctggcgctactgatcagtatgcagtggcagttcagggctatccgcacc
atccagcaggaaacgctggcgctgtggagtgccgataacgcgctgattgtagcccgcggc
gggaaactcaaagcctcagagggaaacgaacgccagcgggatctcagttttcgctggcaa
ctgaccgctacaacccgctcttcacaaactgagcgccagcagatcgttgtgtcggggcca
gatgacacgatgtcgtcgctttcagcatggcttccggtggagccagcagaatga

DBGET integrated database retrieval system