KEGG   Citrobacter rodentium: ROD_44971
Entry
ROD_44971         CDS       T01145                                 
Symbol
gspD
Name
(GenBank) putative T2SS protein D
  KO
K02453  general secretion pathway protein D
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_44971 (gspD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_44971 (gspD)
Secretion system [BR:cro02044]
 Type II secretion system
  General secretion pathway protein
   ROD_44971 (gspD)
SSDB
Motif
Pfam: Secretin Secretin_N GNAT_acetyltr_2
Other DBs
NCBI-ProteinID: CBG91192
UniProt: D2TMH8
LinkDB
Position
complement(4752127..4754115)
AA seq 662 aa
MLTRFRLTGISLALLLVTSGTPALSANYTANFNNADIKTFVDIVGQNMGKTILLAPDVSA
SISVRSADVFTEEEYYQFFLSVLDLYGFSIVTLDNGILKVVRSDRVKTAPGRLSSDAHPG
KGDELVTRVVPLDNVPARALAPLLRQMLDATGAGNVVHYEPSNVLIITGKASAVNRVLEV
VKRVDVIGTEKEQIIPLRYASAVDLAEVLNDLARESGKEARPATLQTRIVADERSNSLIV
SGSDRARARVVRLATHLDTQEQGQGNTRVWYLKYAKADKLVEVLTGVSQQMESENGKAPK
TSAPSSNNAISITADEQTNSLVITANQSQLQQLEPVIEKLDIRRAQVLVEAIIVEVQDGK
GLNLGVQWANKNIGATQFTNTGLPIFNAAQGVKEFKKQGGITSDNPAYDLFSKYRGMAAG
FFSGDWAVLLTALSSDSKNDILSTPSIVTLDNKEASFNVGQDVPVLSGSQTTSGDNIYST
VERKTVGTKLKVTPQINEGDSVLMEIEQEVSSVDSTASSSSLGPTFNTRTIQNAVLVKSG
ETVVLGGLMDDSSKEEVSKVPLLGDIPFIGQLFRYTNHEKSKRNLMVFIRPTIIRDDDVY
RSLSREKYTHFRDIQKTRADKNSSQLINVEAIDALDDAAFEHTPAAKSASKPANPFSNGA
AK
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgcttacccgttttcgcctgacaggcatttcgctggcacttctgctggtgacatccggt
acgccagcgctgtcggcgaattatacggcaaactttaataacgccgatattaagaccttt
gtcgatatcgtcggccagaatatgggcaaaacgattctgctggcgccggacgtcagcgcg
tccatttcggtcagaagcgcggatgtttttaccgaagaagagtactaccagttttttctc
agcgtacttgatttatacggtttctccatcgtcacgctggataacggcatccttaaggtt
gtacgttcagacagggtaaagacggcaccaggccgactctccagcgacgcacatcccggt
aaaggcgatgaattagtgacccgggtagtcccgctggacaatgtgcccgcccgcgcgctg
gcgccgttgctgcgtcaaatgctggacgccactggcgccggcaatgtggtgcactatgaa
ccgtcaaacgtcctgatcattaccggcaaggcttctgcggtcaatcgcgtgctggaagtg
gtgaaacgcgtggacgttataggcacggaaaaggagcagattattccgctcagatatgcc
tccgccgtcgaccttgccgaagtgcttaacgatctggcgcgtgaaagcggtaaggaagcg
cgcccggcgaccctgcaaacccgtatcgtcgccgacgagcgcagcaattcgctgattgtc
agcggctccgatcgcgcccgcgccagagtcgtccggctggcgacacaccttgatacccag
gaacaggggcagggaaacacccgcgtctggtatctcaaatatgccaaagcggataagctg
gtcgaggtgttgaccggcgtttcccagcagatggagagcgaaaatggcaaagcgccaaaa
acgagcgcccccagcagcaataacgccatttccattaccgcagacgaacagaccaactcg
ctggtcattaccgcgaatcaaagtcagcttcagcaactggagccggttattgagaagctg
gatattcgccgtgcgcaggtgctggtcgaagccattatcgttgaggtccaggacggtaag
gggctgaatcttggcgtgcagtgggccaataaaaatatcggcgccacccagtttactaat
acaggcttacctattttcaatgctgcgcagggggtgaaagagtttaaaaaacagggcggc
atcaccagcgataacccggcatacgatctctttagtaagtaccgtggcatggcggctggc
tttttcagcggcgactgggcggtgctgctgacagcgttaagctccgacagtaaaaacgat
attttatccacccccagcatcgtcacgctggataacaaagaagcctccttcaacgtcggc
caggatgttcccgtgctctccggttcgcaaaccacctccggagataatatctacagtact
gtcgaacgcaaaaccgtcggcaccaagctcaaagtcacgccgcaaataaacgaaggcgac
tcggtgctcatggagattgagcaggaggtttccagcgtcgattctaccgcctcttcttca
tcgcttggacccacgttcaacacccgcaccattcagaacgccgtgctggtcaaaagcggc
gaaacggtggtgctgggcggcctgatggatgactcaagtaaagaagaagtctccaaagtg
ccgttactgggggacattccgtttatcggtcagctctttcgctataccaatcatgaaaaa
agcaaacgtaacctgatggtatttattcgtccgactatcatcagagacgatgatgtctat
cgctcgttatcacgcgaaaaatacacccactttcgcgacatacaaaaaacgcgcgcggat
aaaaacagcagtcagttgatcaacgtcgaggccattgatgcgttggatgatgcggcattt
gagcatacacccgcagcgaaaagcgcatccaaaccggccaacccgttcagtaacggcgcg
gcaaaatga

DBGET integrated database retrieval system