KEGG   Citrobacter rodentium: ROD_45221
Entry
ROD_45221         CDS       T01145                                 
Symbol
secY
Name
(GenBank) preprotein translocase subunit SecY
  KO
K03076  preprotein translocase subunit SecY
Organism
cro  Citrobacter rodentium
Pathway
cro02024  Quorum sensing
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_45221 (secY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_45221 (secY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_45221 (secY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_45221 (secY)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_45221 (secY)
SSDB
Motif
Pfam: SecY Orf78 DUF2140 DUF6264
Other DBs
NCBI-ProteinID: CBG91217
UniProt: D2TN87
LinkDB
Position
4766355..4767686
AA seq 443 aa
MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTI
IEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYT
RYGTLVLAIFQSIGIATGLPNMPGMQGLVMNPGFAFYFTAVVSLVTGTMFLMWLGEQITE
RGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERG
QRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGW
NWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGE
QTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQV
QTLMMSSQYESALKKANLKGYGR
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggctaaacaaccgggattagattttcaaagtgccaaaggtggcttaggcgagctgaaa
cgcagactgctgtttgttatcggtgcgctgattgtgttccgtattggctcttttattccg
atccctggtattgatgccgctgtacttgccaaactgcttgagcaacagcgaggcaccatc
attgaaatgttcaacatgttctctggtggtgctctcagccgtgcttctatctttgctctg
ggtattatgccgtacatttcggcatcgattattatccagctgctgacggtggttcaccca
acgctggcggaaataaagaaagaaggggagtctggtcgacgtaagatcagccagtacacc
cgctacggtactctggtgctggcgatattccagtcgatcggtattgctaccggtctgccg
aatatgcctggtatgcaaggcctggtgatgaacccgggctttgcattctatttcaccgct
gttgtaagtctggtcacaggaaccatgttcctgatgtggttgggcgaacagattactgaa
cgaggtatcggcaacggtatttcaatcattatcttcgccggtattgtcgcgggactcccg
ccagccattgcccatactatcgagcaagcgcgtcaaggcgacctgcacttcctcgtgttg
ctgttggttgcagtattagtatttgcagtgacgttctttgttgtatttgttgagcgtggc
caacgccgcattgtggtaaactacgcgaaacgtcaacagggtcgtcgtgtctatgctgca
cagagcacacatttaccgctgaaagtgaatatggcgggggtaatcccggcaattttcgct
tccagtattattctgttcccggcaaccatcgcgtcatggttcgggggcggtactggttgg
aactggctgacaacaatttcgctgtatttgcagcctgggcaaccgctttatgtgttactc
tatgcgtctgcaatcatcttcttctgtttcttctacacggcgttggtcttcaacccgcgt
gaaacagcagataacctgaagaagtccggtgcatttgtaccaggaattcgtccgggagag
caaacggcgaagtatatcgataaagtaatgacccgcctgactctggtcggtgcgctgtac
attacctttatctgcctgatcccggagttcatgcgtgatgcaatgaaagtaccgttctac
ttcggtgggacctcactgcttatcgttgttgtcgtgattatggactttatggctcaagtg
caaactctgatgatgtccagtcagtatgagtctgcattgaagaaggcgaacctgaaaggc
tacggccgataa

DBGET integrated database retrieval system