KEGG   Citrobacter rodentium: ROD_46121
Entry
ROD_46121         CDS       T01145                                 
Symbol
mtgA
Name
(GenBank) monofunctional biosynthetic peptidoglycan transglycosylase
  KO
K03814  monofunctional glycosyltransferase [EC:2.4.1.129]
Organism
cro  Citrobacter rodentium
Pathway
cro00550  Peptidoglycan biosynthesis
cro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROD_46121 (mtgA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cro01003]
    ROD_46121 (mtgA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_46121 (mtgA)
Enzymes [BR:cro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ROD_46121 (mtgA)
Glycosyltransferases [BR:cro01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   ROD_46121 (mtgA)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   ROD_46121 (mtgA)
SSDB
Motif
Pfam: Transgly
Other DBs
NCBI-ProteinID: CBG91307
UniProt: D2TP74
LinkDB
Position
4870540..4871259
AA seq 239 aa
MKKGLIVFLRRLIVRVALALALFWGGGIALFSVAPVPFSAVMAERQIGAWLRGDFGYVAH
SDWVSMDEISPWMGLAVIAAEDQHFPAHWGFDVAAIEKALSHNERHENRIRGASTLSQQT
VKNLFLWDGRSWLRKGLEAGLTLGVETVWSKKRILTVYLNIAEFGDGVFGVEAAAQRYFG
KPASRLTQSEAALLAAVLPNPLRYKAAAPSGYVRSRQAWIMRQMRQLGGETFMTRNKLY
NT seq 720 nt   +upstreamnt  +downstreamnt
atgaaaaaaggacttatcgtatttctgcggcgcctgattgtacgcgtcgcgctggcgctt
gccctcttctggggcggcggaattgcgctgttcagcgtggcaccggtgccgttttcggcg
gtgatggcggagcggcagattggcgcctggctacggggcgatttcggctatgtcgcccat
tcagactgggtgagtatggatgagatctcgccgtggatggggctggcggttattgccgcg
gaagatcaacactttccggcgcactggggatttgacgttgccgccattgagaaggcgctg
tcgcataatgaacgccatgaaaatcgcatacgcggcgcgtcgacgttgtcacagcaaacg
gtgaaaaatctctttttatgggacggacgtagctggctgcgcaaagggctggaagcgggt
ctgacgctgggcgttgaaaccgtctggagcaaaaagcggatcctgactgtctacctgaat
atcgccgagtttggcgacggcgtctttggcgttgaagcggcggcgcagcgctatttcggc
aaaccggccagcaggctgacgcagtcggaagccgcgctgctcgccgccgtattgccaaat
cccttacgctataaggccgccgcgccttccgggtatgtgcgtagccgacaggcgtggatt
atgcgccagatgcgccagctgggcggcgagacgtttatgacccgcaataagctgtattaa

DBGET integrated database retrieval system