KEGG   Citrobacter rodentium: ROD_p2391
Entry
ROD_p2391         CDS       T01145                                 
Symbol
taxB
Name
(GenBank) putative conjugal transfer coupling protein TaxB
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_p2391 (taxB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_p2391 (taxB)
Enzymes [BR:cro01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ROD_p2391 (taxB)
Secretion system [BR:cro02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ROD_p2391 (taxB)
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: CBG91860
UniProt: D2TVE1
LinkDB
Position
pCROD2:complement(23508..25370)
AA seq 620 aa
MKTFNKSQSVFIFAVMLVAAWFAGSFIFFVLYFSQIKNLKPLKAVFRSIDAYRMDIFTDS
LTLSVVTTDIRVLAFVALGAGFVVSLIIPVAALIKLNEKKDNIFGDARFATTNDIRESNS
FTLDGDEKDGIIVGIKDKKIIRYVGAAFSAMGAGTRAGKGAGIVITNLMKYWWSVIILDP
KRECFNITSLIRKVILGHEVYKFDPFSPVTHRFNPLYYVSMGTSEGFNQLENLALIIYPY
KTDGADAGSYLNKTAGGVFKSYAVALWFMIKNDKAGLKTLDIEPVFSMSKINQLFERAEP
EHLLSFMNDIRSELRGKDKTLADIGVAGLKAFIEMEDKTKAQLKSNFLNGLSPFANPNVA
NATDGNDFDLRQVRKKRMTIYFCISGDNARLAEKITNIFFQLAIQVNLEKMPTDDPEIKH
DCLFLLDEFPSIGAVDYIKSKSGLIAGYKLKLLIVYQVGSQLEEIYSYAGSKTLLASAPC
KIVYSASDVKDARELSEAMGTRTVTIGSKSKSRSRGGTSRSESESLIERPLVTTNELLTL
KFSEEILAMKGENPIRCEKAFYYLHEYFFGDFVKVAPELANIFPRKKGKLVMPPQKVFEN
EIVAKGYLAVKEVPDLDKAA
NT seq 1863 nt   +upstreamnt  +downstreamnt
gtgaaaacttttaataagtcgcaatctgtttttatatttgctgttatgcttgttgcggca
tggtttgcaggttcatttattttctttgtgctttacttcagccagataaagaatctgaaa
ccattgaaggctgtgttcagatccattgatgcgtacaggatggatatttttacagacagc
cttactttatctgttgtgactacggatatcagagttttagcctttgttgcacttggagca
ggatttgtcgtgtctcttattatccctgttgcggcgttaataaaactgaacgagaagaaa
gataatatttttggtgatgcgcgatttgcgacaactaatgatattcgtgagtctaacagt
ttcacgcttgacggtgacgaaaaagacgggattatcgttggtataaaagacaagaaaatc
atacgctatgtgggagcagcattcagtgcgatgggagccggaacaagggctggtaaaggt
gcaggtatagtcatcactaatcttatgaagtactggtggagtgttattattctcgatcca
aaaagggagtgttttaatatcaccagtcttatcaggaaggtgattttaggtcatgaggtt
tataaatttgatccctttagtccggtaacgcaccgctttaaccctttgtattatgtcagc
atgggaacgagtgaaggttttaatcagcttgaaaatcttgcgttgattatttacccctat
aagacagatggtgcggatgctggtagctatcttaataagacggcggggggtgtttttaaa
tcttatgctgtcgctttatggtttatgattaagaatgataaggctggactaaaaacgctt
gatattgagcctgtcttctcaatgtctaaaattaatcagctttttgagcgtgcagaaccc
gaacatcttctttcattcatgaatgatattcgttcagaattaagggggaaagacaaaacg
cttgctgatattggtgtcgctggccttaaggcattcattgagatggaggataaaacaaaa
gcacaactcaaaagcaactttcttaatggattatcaccgtttgctaaccccaatgtggca
aatgctactgatggaaatgattttgatttgcggcaggtgcggaaaaagcggatgacaatt
tatttctgtatttctggtgataatgccaggttggctgaaaaaataacaaatattttcttt
cagcttgctatacaggtgaatcttgaaaagatgccaacggatgatccggaaataaaacat
gactgcctttttctactggatgaattcccgtcaattggtgctgtagattacatcaagagt
aaatctggactcattgctggttacaagctgaaattgttgattgtttaccaggtcggctct
cagcttgaggaaatctacagttatgcaggcagtaaaacattactggcaagtgcaccctgt
aaaatcgtttattccgcttctgatgttaaagatgcgcgggagttatcagaagcgatggga
acacgaacagtaactatcggttcgaaaagcaaaagtcgtagtcgtggaggaacatcgaga
tctgaatcagaaagccttattgagcgtccactggtaacaacaaatgaactacttacactg
aaatttagtgaagaaatcctggcaatgaagggagaaaacccgattcgttgtgaaaaggca
ttctactatctccatgagtatttctttggtgattttgtgaaggttgctccggaacttgca
aacattttccccaggaagaaaggaaagctggttatgcctccacagaaagtatttgaaaat
gaaatcgtcgcaaaagggtatctggcagtaaaagaagttcctgatctcgataaagcggca
taa

DBGET integrated database retrieval system