KEGG   Citrobacter rodentium: ROD_p2401
Entry
ROD_p2401         CDS       T01145                                 
Symbol
triJ
Name
(GenBank) putative conjugal transfer protein TriJ
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_p2401 (triJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_p2401 (triJ)
Enzymes [BR:cro01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ROD_p2401 (triJ)
Secretion system [BR:cro02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ROD_p2401 (triJ)
SSDB
Motif
Pfam: T2SSE AAA_7 FtsK_SpoIIIE ABC_tran Mg_chelatase Pox_A32 VirE ATP_bind_1 TsaE TrwB_AAD_bind RsgA_GTPase NACHT AAA_30 Microtub_bd Viral_helicase1 MobB ResIII AAA_25
Other DBs
NCBI-ProteinID: CBG91861
UniProt: D2TVE2
LinkDB
Position
pCROD2:complement(25357..26385)
AA seq 342 aa
MSGVIPVSISNKSLDFYKNQVFQSFLDIEGLTEIAVNRPGEIWTEINGDWTFHNNDGVTF
DFCKRFSQTLASFRGDEIGDTKPLLSATLESGERVQVVFPPACERNTISITIRKPSTRQI
THKEYVANGFYDYVQSGKKHRTYDDELLDLFRARNIAAFMELAVAAGKTIVFAGATGSGK
TTYMKSLIDFIPLNTRLITIEDAEEIKFFIHKNYVHLFYPSESGSDSGSIITAAKLIKSC
LRMKPDRILLAEIKGGDAWDFVKVAGSGHSGSMTSIHAASAKDAIIQMVTKCYQNRECQN
LPFDVLRKIIMDSIDIVVHVGRDGVVRHMSDIYYKGAECENF
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgagtggcgttattcctgtcagcattagcaataaatcgctcgatttttataaaaatcaa
gtattccagtcttttcttgatattgaagggctaacagaaattgctgtcaaccgtcctggt
gaaatctggacggaaattaatggtgactggacattccataataatgacggtgtgaccttt
gatttttgtaaacggttttctcagacgctggcatcatttcggggagatgaaatcggcgat
accaagccattactttcagcaacactggaatcaggagaacgtgtacaggtcgtttttcct
cctgcatgtgagagaaatactatttcaatcactatacgtaaaccatcgacacggcagata
acgcataaagaatatgtggcgaacggtttttatgattatgtccagtcaggaaaaaaacac
aggacatacgatgatgagcttcttgatttattcagagcgagaaatatcgctgcttttatg
gagcttgccgtagcagcagggaaaaccattgtatttgccggagcaacgggttccggtaaa
acaacctatatgaagagtcttatcgatttcataccattgaatacgcggctgattacgatt
gaagatgcggaggaaatcaaattttttattcataaaaattatgtgcatcttttttaccct
tcggaatccggcagtgattccggctctatcataacagcagcgaaattaatcaaatcctgt
ttgagaatgaaacctgacagaattttactggcggaaattaaaggtggcgatgcctgggat
tttgtgaaagttgctggttctggtcacagtggaagcatgacgtccattcacgcggcctcg
gcaaaagatgccatcattcagatggtgacaaaatgttatcagaacagagaatgtcaaaat
cttccttttgatgttcttcgtaaaatcattatggacagtattgatattgttgttcatgta
ggcagggatggtgttgtcaggcatatgagcgacatctattacaaaggggctgaatgtgaa
aacttttaa

DBGET integrated database retrieval system