KEGG   Citrobacter rodentium: ROD_p2411
Entry
ROD_p2411         CDS       T01145                                 
Symbol
triI
Name
(GenBank) putative conjugal transfer protein TriI
  KO
K03195  type IV secretion system protein VirB10
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_p2411 (triI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_p2411 (triI)
Secretion system [BR:cro02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ROD_p2411 (triI)
SSDB
Motif
Pfam: TrbI SARAF
Other DBs
NCBI-ProteinID: CBG91862
UniProt: D2TVE3
LinkDB
Position
pCROD2:complement(26387..27505)
AA seq 372 aa
MTDMKKTDDLVDDANQSKLESKPVHDIGDIRNKNNRMRSGFLFGLMAVLVIGIFALKTYK
NYFADDQQKASELTGDTSISQVSKIRTGLGQNFDPVENKAIINPGATGSGNTVSDGHKEV
PQEGFRKYLSIPVAGQGGSQTGASGSSRTSQTSEPQEERKESKENVPGKSGMKVTAINLD
PDLYIEENRLIPCALTTRFVSDVAGRISCVFTEDVWSANHHTKLLEQGTKAFGRYQTGTL
NHGQGRMFVMWEQLRTPDNKRIDMVNTAAAGPLGEAGIDGWIDSHFWERFGGSLMLSMVQ
DVAAAAADNAPGKDRNVDYTENSRQAMAEMAKVALENSINIPPTMYKNQGDIITIMVGED
IDFSDIYELKVK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgactgatatgaaaaaaacagatgatttagttgatgatgcgaatcagtcaaagctggaa
agtaaacccgttcatgatatcggtgatatcaggaacaaaaataatcgtatgcgttctggc
tttctgtttggtctgatggctgtattagttattggtatttttgcgctgaaaacatataaa
aattattttgcagatgaccagcagaaagcatcagaattaacaggcgataccagcatttct
caggtcagtaaaatccgtactggtcttggtcagaattttgaccctgttgagaacaaagca
attatcaatccaggcgctactggttctggtaatactgtttctgacggtcataaagaagtg
ccacaggaggggttcaggaaatatttgtcaatacctgttgctggtcagggagggagtcag
actggcgcgagtggcagcagcaggacatcgcagacatcagagccacaggaagaaaggaaa
gaatcaaaagaaaatgtgcctggtaaatcaggaatgaaagtgactgcgattaatctcgat
cctgatctctatattgaggaaaacaggcttataccgtgtgctttaaccacacgctttgtt
tctgatgttgcaggtcgtatcagttgtgtttttacagaagatgtatggagtgctaatcac
cacacaaaattactggaacagggaactaaggcttttggtcgttaccagaccggaacgctg
aatcatggacagggcagaatgttcgttatgtgggagcagttgcggacgcctgataataaa
cgaatcgatatggtaaatacagcagcggctggtcccctgggggaagcaggcattgatgga
tggatcgattctcacttctgggagcgttttggtggttctcttatgctcagtatggttcag
gatgtagcggcggcggcggcggataatgcacctggtaaagatcgtaatgtggattatacc
gaaaactcacgacaggcaatggctgaaatggctaaagtcgcacttgagaattcgataaat
attcctccaacaatgtataaaaaccaaggtgacataatcactattatggtcggggaagac
attgatttttctgatatctatgagttaaaggtaaaatag

DBGET integrated database retrieval system