KEGG   Camelina sativa (false flax): 104700286
Entry
104700286         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase small subunit 2, chloroplastic-like
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104700286
   00660 C5-Branched dibasic acid metabolism
    104700286
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104700286
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104700286
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104700286
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4
Other DBs
NCBI-GeneID: 104700286
NCBI-ProteinID: XP_010414082
LinkDB
Position
7:complement(4551575..4557826)
AA seq 492 aa
MAAISVSSSPSLRCLRSACSDSSPALVSSTRVSFPSKVSYLSGKSSNRGEEMGKRMDGIV
RSVDGKISDASSFPEAPSSTPNSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAV
GLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPES
RAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE
KMGATAPFWRFSAASYPDLKKQAPVSVLRGSKKEVVAPQNETTAGGDVYPVEPPSDHMVH
RVLDAHWGLLSDEDTSGLRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKG
ISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNATARRDVL
DIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARESGVDS
KYLRGYSFPLIG
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcggccatttctgtgagttcttcaccatcgcttcgatgcttgagatcggcatgttcc
gattcgtctcctgctctcgtatcctcgacgcgtgtgtcgttcccttcgaaggtttcgtat
ctgtcaggtaaatcttcgaaccgtggcgaagaaatgggtaagagaatggatggaattgtt
agaagcgtcgatgggaagatctctgatgcatcttctttccccgaagctccatcttcgact
ccaaattcgaaggtgaggaagcacacaatttcagtatttgttggagatgaaagcggaatg
attaataggattgcaggagtctttgcgaggagaggttacaatattgagagtcttgctgtt
ggtttgaacagagacaaggctctgttcactattgttgtttgtggaactgaaagggtactt
cagcaggtcatcgagcaactccagaagctcgttaatgttctaaaggttgaagatatctca
agtgagccgcaagtggagcgtgaactgatgcttgtaaaagtgaatgcacatccagaatcc
agggcagagatcatgtggctagttgacacattcagagctaaagttgtagatatcgcggaa
catgcattgactattgaggtaactggagatcctggaaaaatgattgctgtagaaagaaat
ttgaaaaagtttcagatcagagagattgtacggacaggaaagatagcactaagaagggaa
aagatgggtgcaactgctccattttggcggttttcagcagcatcctatccagatctcaag
aagcaagcacctgttagtgttcttcgaggtagcaaaaaagaagtcgtggcccctcaaaat
gaaacaacagcagggggagatgtttatccggttgagccaccttctgaccacatggtacat
cgtgttctcgacgcacactggggacttctctctgatgaggatacgagtggactacggtcg
catactctatctttgcttgtgaatgatgttccaggagttcttaatattgtgactggtgtt
ttcgctcgaaggggatacaatattcagagcttggctgtaggacatgctgaaaccaagggc
atttcacgcattacaacagttgttcctgcaacagatgaatcggtcagcaaattggtgcag
caacttaataaacttgtagatgtgcatgaggtccatgatcttactcatttgccatttgct
gaaagagaactgatgctgattaagattgccgtgaacgctactgcaagaagagatgtccta
gacattgctagtattttcagggctaaagctgttgacgtatccgatcacacaattactttg
cagcttactggggatctagacaagatggttgcgctgcaaaggttgttggagccctacggt
atatgcgaggttgcaagaaccggacgtgttgcattggctcgtgaatcgggagtggactcc
aagtatcttcgtggatactcctttcctttaattggttga

KEGG   Camelina sativa (false flax): 104705918
Entry
104705918         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase small subunit 1, chloroplastic-like
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104705918
   00660 C5-Branched dibasic acid metabolism
    104705918
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104705918
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104705918
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104705918
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 NikR_C
Other DBs
NCBI-GeneID: 104705918
NCBI-ProteinID: XP_010420316
LinkDB
Position
8:3279089..3283366
AA seq 481 aa
MAAAATATATAASLYPSRVHFQNQSKVYGFPAKTPNSVRVTQIIDGRKMRNATVLSSAST
DKAITTAQSLAPRACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVALNEDKA
LFTIVVLGTDKVLQQVVEQLNKIVNVIKVEDISKEPHVERELMLIKLNADPSTRSEIMWL
MDIFRAKIVDTSEHSLTIEVTGDPGKMVALERNLEKFGIKEIARTGKIALRREKMGETAP
FWRFSAASCSLHLKEPPHETVTEKTKLAMTGNGNASSGGDVYPVEPYDDFKPVLDAHWGM
VYEEDSSGNRSHTLSILVANAPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIP
GTDDHIDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSTRRDILDIAHVFRAK
AIDVSDHTITLEVAGDLRKMAALQTQLEVYGICEVARTGRVALVRESGVDSTYLRGYSLP
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgacggctacggctacggctgcttcattgtacccatctcgtgttcac
ttccagaaccagagcaaagtttatggctttccggcaaaaaccccgaactcagtcagagta
actcagatcatcgatgggagaaagatgaggaatgccactgttctatcctctgcttccacc
gataaagccatcaccactgctcagtctttagctcccagagcttgtgatagagtaaggagg
cataccatctcggtgtttgtgggtgatgagagcggtataataaaccggatagctggtgtg
tttgctagaaggggatataatattgagtcccttgccgtggccttgaatgaagacaaggct
ctctttactatagttgttcttgggacagacaaagtcctgcaacaagttgtagaacagctt
aacaaaatcgtcaatgtcatcaaggtggaagatatctccaaggagccgcatgtagaacgt
gaactaatgctcattaaacttaatgctgatccaagcacccgttcagagatcatgtggttg
atggatatctttagagcaaaaatcgtggatacctcggagcactctctaacgattgaggta
actggagacccaggaaaaatggttgcacttgagagaaacttagagaagtttggaataaaa
gaaatcgcgagaacagggaagattgctctgagacgggaaaagatgggagaaaccgctccg
ttttggagattttcagcggcatcatgctcacttcatttgaaggaaccgcctcatgagact
gttacagagaaaacaaagctagcaatgactggaaatggcaatgcatcatcggggggtgac
gtttatccagtggaaccctatgatgatttcaaaccggtccttgacgctcattggggaatg
gtatacgaagaagattcgagtggaaaccggtcccacacgttatctatacttgtagcgaac
gcacccggagttcttaatctaataaccggagctatctctaggaggggttataacatccag
agtctagctgttggtcctgctgagaaagaaggcttatctcggattacgacagttatccct
ggaactgatgatcatatagacaaattggttaggcagcttcagaagttgattgatcttcac
gaggtccaaaatattacccacatgccatttgcggagcgagaactgatgctcatcaaagta
gccgctcatacttctacaaggagagatattctagatattgctcatgttttccgtgctaag
gccattgatgtctctgatcatactatcactcttgaggttgcgggagatctcagaaaaatg
gctgcactacaaactcagttggaggtgtatggaatctgtgaggtggcccggacaggaaga
gtggcattggtaagagaatctggagtggattcgacttatcttcgtggatactctcttcct
ttgtag

KEGG   Camelina sativa (false flax): 104711352
Entry
104711352         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase, chloroplastic-like isoform X1
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104711352
   00660 C5-Branched dibasic acid metabolism
    104711352
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104711352
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104711352
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104711352
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 104711352
NCBI-ProteinID: XP_010426353
LinkDB
Position
9:complement(18986202..18989521)
AA seq 666 aa
MAAATTPSSSSIPFSTKPSSSKSPLPISRFTLPFALNPTKSSSSRRRGIKSTSLSISAVL
NTTTNVSTTTPPSKPTKPEKKKFVSRFAPDQPRKGADILVEALERQGVETVFAYPGGASM
EIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSTGKPGICIATSGPGATNLVSGLADALL
DSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIVEEAFFLATS
GRPGPVLVDVPKDIQQQLAIPNWEQAMRLPGYMSRMPKPPEDSHLEQIVRLISESKKPVL
YVGGGCLNSSEELGRFVELTGIPVASTLMGLGAYPCDDELSLHMLGMHGTVYANYSVEHS
DLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNK
VLENRAEELKLDFGVWRSELNEQKQKFPLSFKTFGEAIPPQYAIQVLDELTDGRAIISTG
VGQHQMWAAQFYKYKKPRQWLSSAGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMN
VQELATIRVENLPVKILILNNQHLGMVMQWEDRFYKANRAHTYLGNPGAEDEIFPNMLQF
ASACGIPAARVTKKAELREAIQKMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDVITEG
DGRTKY
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggcggcggcaacaacaccatcatcatcttcgatccccttctcaacaaaaccttcctcc
tccaaatcaccattaccaatctccaggttcaccctcccattcgcactaaaccccaccaaa
tcctcctcctcccgccgccgcggtatcaaatcaacctccctctccatctccgccgtgctc
aacacaaccaccaatgtctcaaccacaactcctccatcaaaaccaaccaaacccgaaaaa
aaaaaattcgtctcccgattcgctccagatcagccacgcaaaggcgctgacatcctcgtc
gaagctttagaacgtcaaggcgtagaaacagtcttcgcttacccaggaggtgcatcaatg
gagattcaccaagccttaactcgttcctcctcgatccgtaacgtccttccacgtcacgaa
caaggaggcgtattcgcagctgaaggctacgctagatccacaggtaaaccaggtatctgt
atagcaacctcaggtcctggagctacaaatctcgttagcggattagccgatgccttgtta
gatagtgttcctcttgtagcgatcacgggtcaagtccctcgtaggatgattggtactgat
gcgtttcaagaaactcccatcgttgaggtgacgcgttcgattactaaacataactatctt
gtgatggatgttgaagatattcctaggattgttgaggaagctttctttttagctacttct
ggtagacctggacctgttttggttgatgttcctaaagatatccagcagcagcttgcgatt
cctaattgggaacaggctatgaggttacctggttatatgtctaggatgcctaaacctccg
gaagattctcatttggagcagattgttaggttgatttctgaatctaagaagcctgtgttg
tatgttggtggtggttgtttgaattcgagtgaggagttgggtaggtttgttgaacttact
ggtatccctgttgcgagtacgttgatgggtcttggtgcttatccttgtgatgatgagttg
tcgttgcatatgcttggcatgcacgggaccgtgtatgctaattactctgtggagcatagt
gatctgttgttggcttttggggtgaggtttgatgatcgtgtcacgggtaagcttgaggct
tttgctagtagggcgaagattgttcacattgatattgactcggctgagattgggaagaac
aagactcctcatgtgtctgtgtgtggagatgttaagttggctttgcaagggatgaacaag
gttcttgagaaccgagctgaggagcttaagcttgatttcggggtttggagaagtgagttg
aacgaacagaaacaaaagttccctctgagcttcaagacgtttggggaagctattcctcca
cagtatgcgattcaggtccttgatgagctgactgatgggagagccattataagcactggt
gtcggtcagcatcaaatgtgggcggcgcagttttacaagtacaaaaaaccaaggcagtgg
ctatcatcagcaggccttggagctatgggttttggacttcccgctgctattggagcgtcc
gttgcgaaccctgatgcgattgttgtggatattgacggagatggaagcttcataatgaat
gtgcaagagctggccactatcagggtagagaatctcccagtgaagatacttatactaaac
aaccagcatcttggcatggttatgcaatgggaggatcggttctacaaagctaaccgagct
cacacatatcttggtaacccgggagcggaggacgagatattcccgaacatgctgcagttt
gcatcagcttgcgggattccagcggcgagggtgacaaagaaagcagagctccgagaagct
atccagaaaatgctggataccccaggaccatacttgttggatgtgatttgtccgcaccaa
gagcatgtgttgccgatgatcccaagtggcggcactttcaatgatgtcataacggaagga
gatggccggacgaaatactga

KEGG   Camelina sativa (false flax): 104735655
Entry
104735655         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase small subunit 1, chloroplastic
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104735655
   00660 C5-Branched dibasic acid metabolism
    104735655
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104735655
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104735655
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104735655
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 NikR_C
Other DBs
NCBI-GeneID: 104735655
NCBI-ProteinID: XP_010453787
LinkDB
Position
13:6961873..6966124
AA seq 479 aa
MAAAATATAASLYASPVHFQSQNKGYGFQPKSPNSVKVTQIIDGRKMRNATVLSSASTDK
AITTAQSVAPRACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALF
TIVVLGTDKVLQQVVEQLNKIVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVD
IFRAKIVDTSEHSLTIEVTGDPGKMVALERNLEKFGIKEIARTGKIALRREKMGETAPFW
RFSAASCSLHLKEPPHETVAEKTKLAMTGNGNASSGGDVYPVEPYDDFKPVLDAHWGMVY
EEDSSGNRSHTLSILVANAPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGT
DDHIDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSTRRDILDIAHVFRAKAI
DVSDHTITLEVAGDLRKMAALQTQLEVYGICEVARTGRVALVRESGVDSTYLRGFSLPL
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgacggctacggctgcttcattgtacgcatctcctgttcacttccag
agccagaacaaaggttatggctttcagccaaaatcccccaactcagtcaaagtaactcag
atcatcgatgggagaaagatgaggaatgccactgttctatcctctgcttccaccgataaa
gccatcaccactgctcagtctgtagctccgagagcttgtgatagagtaaggaggcataca
atctcggtgtttgtgggtgatgagagcggtataataaacaggatagctggtgtgtttgct
agaaggggatataatattgagtcccttgctgtggggttgaatgaagacaaggctttgttt
actatagttgttcttgggacagacaaagtcctgcaacaagttgtagaacaacttaacaaa
atcgtcaatgtcatcaaggtggaagatctctccaaggagccgcatgttgaacgtgaactt
atgctcattaaacttaatgctgatccaagcacccgttcagagatcatgtggttggtggat
atcttcagagcaaaaatcgtggatacctcggagcactctctaacgattgaggtaactgga
gacccaggaaaaatggttgcacttgagagaaacttagagaagtttggaataaaagaaatc
gcgagaacagggaagattgctctgagacgggaaaagatgggagaaaccgctccgttttgg
agattttcagcggcatcatgctcacttcatttgaaggaaccgcctcatgagactgttgca
gagaaaacaaagctagcaatgactggaaatggcaatgcatcatcggggggtgacgtttat
ccagtggaaccctatgatgatttcaaaccggtccttgacgctcattggggaatggtatac
gaagaagattcgagtggaaaccggtcccacacgttatctatacttgtagcgaacgcaccc
ggagttcttaatctaataaccggagctatctctaggaggggttataacatccagagtcta
gctgttggtcctgctgagaaagaaggcttatctcggattacgacagttatccctggaact
gatgatcatatagacaaattggttaggcagcttcagaagttgattgatcttcacgaggtc
caaaatattacccacatgccatttgcggagcgagaactgatgctcatcaaagtagccgct
catacttctacaaggagagatattctagatattgctcatgttttccgtgctaaggccatt
gatgtctctgatcatactatcactcttgaggttgcgggggatctcagaaaaatggctgca
ctacaaactcagttagaggtctatggaatctgtgaggtggctcggacaggaagagtggca
ttggtaagagaatctggagtggattcgacttatcttcgtggattctctcttcctttgtag

KEGG   Camelina sativa (false flax): 104746770
Entry
104746770         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase small subunit 1, chloroplastic-like
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104746770
   00660 C5-Branched dibasic acid metabolism
    104746770
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104746770
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104746770
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104746770
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 NikR_C
Other DBs
NCBI-GeneID: 104746770
NCBI-ProteinID: XP_010466593
LinkDB
Position
15:14354313..14356859
AA seq 421 aa
MAATVTAASLYPSRVHFQNQNKGCGFSEKTPNSVQVTQIIDGRRTRNATALSANSSNLWI
SRSDSFFSISWLELFIFRVRRHTISVFVGDERGMINRIAGVFASRGYNTESLAMGLNEDK
ALFTIVVLGTDKVLQQVVEQLNKLDNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMW
LVDIFRAKIVDTSEHSLMIEGTGDSGKLVALERNLEKFGIKEIARTGKIALRREKMGETA
PFWRFAAASCSLVHLKEPSHETVAEKTKLALTGNGHASSGGDVYPVEPYDDFKPVLDAHW
GMVYDEDSRGNRSHTLSILVTNVPRVLNLITGAISRRGYNIQSLAVGPAEKEGLCRITTV
IPGTDDHIDKLVRQLQMLIDLHEVLNITNMPFAERELMLIKVAAHTCARRVIEAVKMHNN
K
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcggcgactgtgacagctgcttcattgtacccatcacgtgtccacttccagaaccag
aacaagggttgtggcttttcggaaaaaacccccaactcagtccaagtaactcagatcatc
gatgggaggagaacgaggaatgccactgctctctccgcgaatagtagtaatttgtggatc
agtcgatcagatagttttttctcaatatcatggcttgaactttttattttcagagtaagg
aggcatacaatctcggtgtttgtgggtgatgagaggggtatgataaaccggatagctggt
gtgtttgctagtaggggatataatactgagtctcttgccatggggttgaatgaagacaag
gctctgtttactatagttgttcttgggacagacaaagtcctccaacaagttgtagaacag
cttaacaaactcgacaatgtcatcaaggtggaagatctatctaaggagccgcatgtagaa
cgtgaactaatgctcattaaacttaatgctgatccaagcacccgttcagagatcatgtgg
ttggtggatatctttagagcaaaaatagtggatacctctgagcactctctaatgattgag
ggaactggagactcaggaaaattagttgcacttgagagaaacttagagaagtttggaata
aaagaaatcgcgagaacagggaagattgctctgagacgggaaaagatgggagaaaccgct
ccgttttggagatttgcagcggcgtcatgctcactagttcatttaaaggaaccgtctcat
gagactgttgcagagaaaacaaagctagcattgactggaaatggccatgcatcatcgggg
ggtgacgtttatccagtggaaccctatgatgatttcaaaccggtccttgacgctcattgg
ggaatggtatacgacgaagattcgagaggaaaccggtctcacacgttatcgatacttgta
acgaacgtacccagagttcttaacctaataaccggagctatctctaggaggggttataac
atccagagtctagctgttggtcctgctgagaaagaaggcttatgtcggattacgacagtt
atccccggaactgatgatcatatagacaaattggttaggcagcttcagatgttgattgat
cttcacgaggtcctaaatattaccaacatgccatttgcggagcgagagctgatgctcatc
aaagtagcagctcatacttgtgcaaggagagtgatagaagcagtgaaaatgcataataat
aagtaa

KEGG   Camelina sativa (false flax): 104749691
Entry
104749691         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase small subunit 2, chloroplastic isoform X1
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104749691
   00660 C5-Branched dibasic acid metabolism
    104749691
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104749691
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104749691
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104749691
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4
Other DBs
NCBI-GeneID: 104749691
NCBI-ProteinID: XP_010469674
LinkDB
Position
16:complement(4167157..4171861)
AA seq 492 aa
MAAISVSSSPSLRCLRSACSDSSPAFVSSTRVSFPAKVSYLSGKSLNRGEEMGKRMDGIV
RSVDGKISDSSFPGASSSTPTSNRVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAV
GLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPES
RAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE
KMGATAPFWRFSAASYPDLKNQAPVSVLRGSKKEVMVPQNETTAGGDVYPVEPPSDHMVH
RVLDAHWGLLSDEDTSGLRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKG
ISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNAAARRDVL
DIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRFLEPYGICEVARTGRVALARESGVDS
KYLRGYSFPLTG
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcggccatttctgtaagttcttcaccatcgcttcgatgcttgagatcggcatgttcc
gattcatcgcctgctttcgtatcctcgacgcgtgtgtccttcccggcgaaggtttcgtat
ctgtcgggtaaatccttgaaccgtggcgaagaaatgggtaagagaatggatggaatcgtt
agaagcgtcgatgggaaaatctctgactcatctttccccggagcttcatcttcgactcca
acttccaacagggtgaggaagcacacaatttcagtatttgttggagacgaaagcggaatg
attaataggattgcaggagtctttgcgaggagaggatacaatattgagagtcttgctgtt
ggtcttaacagagacaaggctctattcaccattgttgtctgtggaactgaaagggtgctt
cagcaggtcatcgagcaacttcagaagctcgttaatgttctaaaggttgaagatatctca
agtgagccgcaagtggagcgtgaactgatgcttgtaaaagtgaatgcacatccagaatcc
agggcagagatcatgtggctagttgacacattcagagctaaagttgtagatatcgcggaa
catgcattgactattgaggtaactggagatcctggaaagatgattgctgtagaaagaaat
ttgaaaaagtttcagatcagagagattgtacggacaggaaagatagcactgagaagggaa
aagatgggggcaactgctccattttggcgattttcagcagcatcctatccagatctcaag
aaccaagcacctgttagtgttcttcgaggtagcaaaaaagaagtcatggtccctcaaaat
gaaacaacagcagggggagatgtttatcccgttgagccaccttctgaccacatggtacat
cgtgttctcgacgcacactggggacttctctctgatgaggatacgagtggactacggtcg
catactctatctttgcttgtgaatgatgttccaggagttcttaatattgtgactggtgtt
ttcgctcgaaggggatacaatattcagagcttggctgtaggacatgctgaaaccaagggc
atttcacgcattacaacagttgttcctgcaacagatgaatcggtcagcaaattggtgcag
caacttaataaacttgtagatgtgcatgaggtccatgatctgactcatttgccatttgct
gaaagagaactgatgctgattaagattgccgtgaacgctgctgcgagaagagatgtccta
gacattgctagtattttcagggctaaagctgttgacgtatccgatcacacaattactttg
cagcttactggggatctagacaagatggttgcgctgcaaaggtttttggagccctacggt
atatgcgaggttgcaagaaccggacgtgttgcattggctcgtgaatcgggagtggactcc
aagtatcttcgtggatactcctttcctttaactggttga

KEGG   Camelina sativa (false flax): 104769892
Entry
104769892         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase small subunit 1, chloroplastic-like
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104769892
   00660 C5-Branched dibasic acid metabolism
    104769892
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104769892
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104769892
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104769892
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 NikR_C
Other DBs
NCBI-GeneID: 104769892
NCBI-ProteinID: XP_010492512
LinkDB
Position
20:7511548..7515375
AA seq 479 aa
MATAATATAASLYPSHVHFQNQNKVYGFPPKSPNSVKVTQIIDGRKMRNATVLSSASTDK
AITTAQSISPRACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALF
TIVVLGTDKVLQQVVEQLNKIVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLMD
IFRAKIVDTSEHSLTIEVTGDPGKMVALERNLEKFGIKEIARTGKIALRREKMGETAPFW
RFSAASCSLHLKQPPHETVTEKTKLAMTGNGNASSGGDVYPVEPYENFKPVLDAHWGMVY
EEDSSGNRSHTLSILVANSPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGT
DDHIDKLVRQLQKLIDLHEVHNITHMPFAERELMLIKVAAQTSTRRDILDIAQVFRAKAI
DVSDHTITLEVAGDLRKMAALQTQLEVYGICEVARTGRVALVRESGVDSTYLRGFSLPL
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcgacggcggcgacggctacggctgcttcattgtacccatctcatgttcacttccag
aaccagaacaaagtttatggctttccaccaaaatcccccaactcagtcaaagtaactcag
atcatcgatgggagaaagatgaggaatgccactgttctatcctctgcttcaactgataaa
gccatcaccactgctcagtctatatctcccagagcttgtgatagagtaaggagacatacc
atctcggtgtttgtgggtgatgagagcggtataataaacaggatagctggagtgtttgct
aggagaggatataatattgagtcccttgccgtggggttgaatgaagacaaggctttgttt
actatagttgttcttgggacagacaaagtcctgcaacaagttgtagaacagcttaacaaa
atcgtcaatgtcatcaaggtggaagatctctccaaggagccgcatgttgaacgtgaactt
atgctcattaaacttaatgctgatccaagcacccgttcagagatcatgtggttgatggat
atctttagagcaaaaatcgtggatacctcggagcactctctaacgattgaggtaactgga
gacccaggaaaaatggttgcacttgagagaaacttagagaagtttggaataaaagaaatc
gcgagaacagggaagattgctctgagacgggaaaagatgggagaaaccgctccgttttgg
agattttcagcggcatcatgctcacttcatttgaagcaaccgcctcatgagactgttaca
gagaaaacaaagctagcaatgactggaaatggcaatgcatcatcggggggtgacgtttat
ccagtggaaccctatgaaaatttcaaaccggtccttgacgctcattgggggatggtatac
gaagaagattcgagtggaaaccggtcccacacgttatctatacttgtagcgaactcaccg
ggagttcttaatctaataaccggcgctatctctaggaggggttataacatccagagtcta
gctgttggtcctgctgagaaagaaggcttatctcggattacgacagttatccccggaact
gatgatcatatagacaaattggttaggcagcttcagaagttgattgatcttcacgaggtc
cataatattacccacatgccatttgcggagcgagaactgatgctcatcaaagtagcagct
caaacttctacaaggagagatattctagatattgctcaagttttccgtgctaaggccatt
gatgtctctgatcatactatcacccttgaggttgcgggggatctcagaaaaatggctgca
ctacaaacgcagttagaggtctatggaatctgtgaggtggctcggacaggaagagtggca
ttggtaagagaatctggagtggattcgacttatcttcgtggattctctcttcctttgtag

KEGG   Camelina sativa (false flax): 104780671
Entry
104780671         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase, chloroplastic
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104780671
   00660 C5-Branched dibasic acid metabolism
    104780671
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104780671
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104780671
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104780671
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 104780671
NCBI-ProteinID: XP_010503496
LinkDB
Position
4:complement(15576760..15579020)
AA seq 667 aa
MAAATTTSSSSIPFSTKPSSSKSPLPISRFTLPFSLNPNKSSSSSRRRGIKSTSLSISAV
LNTTANVSTTTPPSKPTKPEKKKFVSRFAPDQPRKGADILVEALERQGVETVFAYPGGAS
MEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSTGKPGICIATSGPGATNLVSGLADAL
LDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIVEEAFFLAT
SGRPGPVLVDVPKDIQQQLAIPNWEQSMRLPGYMSRMPKPPEDSHLEQIVRLVSESKKPV
LYVGGGCLNSSEELGRFVELTGIPVASTLMGLGAYPCDDELSLHMLGMHGTVYANYSVEH
SDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMN
KVLENRAEERKLDFGVWRSELNEQKQKFPLSFKTFGEAIPPQYAIQVLDELTDGKAIIST
GVGQHQMWAAQFYKYKKPRQWLSSAGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIM
NVQELATIRVENLPVKILILNNQHLGMVMQWEDRFYKANRAHTYLGNPAAEDEIFPNMLQ
FASACGIPAARVTKKAELREAIQKMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDVITE
GDGRTKY
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggcggcggcaacaacaacatcatcatcttcgatccccttctcaacaaaaccttcctca
tccaaatcaccattaccaatctccaggttcaccctcccattctccctaaacccaaacaaa
tcctcctcctcctcccgccgccgcggtatcaaatcaacctccctctccatctccgccgtt
ctcaacacaacagccaatgtctcaaccactactcctccatcaaaaccaaccaaacccgaa
aaaaagaaattcgtctcccgatttgctccagatcagccacgcaaaggcgctgacatcctc
gtcgaagctttagaacgccaaggcgtagaaacagtcttcgcttacccaggaggtgcatca
atggagattcaccaagccttaactcgttcctcctcgatccgtaacgtcctcccacgtcac
gaacaaggaggcgtgttcgcagctgaaggatacgctagatccaccggtaaaccaggtatc
tgtatagctacctcaggtcctggagctacgaatctcgttagcggattagccgatgccttg
ttagatagtgttcctcttgtagcgatcacgggtcaagtccctcgtaggatgattggtact
gatgcgtttcaagaaactcccatcgttgaggtgacgcgttccattactaaacataactat
cttgtgatggatgttgaagatattcctaggattgttgaggaagctttctttttagctact
tctggtagacctggacctgttttggttgatgttcctaaagatatacagcagcagcttgcg
attcctaattgggaacagtctatgaggttacctggttatatgtctaggatgcctaaacct
ccggaagattctcatttggagcagattgttaggttggtttctgagtctaagaagcctgtg
ttgtatgttggtggtggttgtttgaattcgagtgaggagttgggtaggtttgtggaactt
acgggtatacctgttgcgagtacgttgatgggtcttggtgcttacccttgtgatgacgag
ttgtcgttgcatatgcttggaatgcacgggaccgtgtacgcgaattactctgtggagcat
agtgatttgttgttggcttttggggtgaggtttgatgatcgtgtcacgggtaagcttgag
gcttttgctagtagggcgaagattgttcacattgatattgactcggctgagattgggaag
aacaagactcctcatgtgtctgtgtgtggagatgttaagctggctttgcaagggatgaac
aaggttcttgagaaccgagctgaggagcgtaagcttgattttggagtttggagaagtgag
ttgaacgaacagaaacaaaagttccctctgagcttcaagacgtttggggaagctattcct
cctcagtatgcgattcaggtccttgatgagctgactgatgggaaagccattataagcact
ggtgtcggtcaacatcaaatgtgggcggcgcagttttacaagtacaaaaaaccgaggcag
tggctatcatcagcaggccttggagctatgggttttggacttcccgctgctattggagcg
tccgttgcgaaccctgatgcgattgttgtggatattgacggagatggaagcttcataatg
aatgtgcaagagctggccactatcagggtagagaatctcccagtgaagatacttatacta
aacaaccagcatcttggcatggttatgcaatgggaggatcggttctacaaagctaaccga
gctcacacatatcttggtaacccggcagcggaggacgagatattcccgaacatgctgcag
tttgcatcagcttgcggtattccagcggcgagggtgacaaagaaagcagagctccgagaa
gctatccagaaaatgctggataccccaggaccatacttgttggatgtgatttgtccgcac
caagaacatgtgttgccgatgatcccaagtggcggcactttcaatgatgtcataacggaa
ggagatggccggactaaatactga

KEGG   Camelina sativa (false flax): 104786433
Entry
104786433         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase small subunit 2, chloroplastic
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104786433
   00660 C5-Branched dibasic acid metabolism
    104786433
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104786433
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104786433
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104786433
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4
Other DBs
NCBI-GeneID: 104786433
NCBI-ProteinID: XP_010510152
LinkDB
Position
5:complement(10484946..10489459)
AA seq 492 aa
MAAISVSSSPSLRCLRSACSDSSPALVSSTRVSFPSKVSYLSGKSSNRGEEMGKRIDGIV
RSVDGKISDASSFPEASSATPNSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAV
GLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPES
RAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE
KMGATAPFWRFSAASYPDLKKQAPVSVLRGSKKEAVIPQNETTAGGDVYPVEPPSDHMVH
RVLDAHWGLLSDEDTSGLRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKG
ISRITTVVPATDESVSKLVQQLNKLVDVHAVHDLTHLPFAERELMLIKIAVNAAARRDVL
DIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARESGVDS
KYLRGYSFPLTG
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcggccatttctgtaagttcttcaccatcgcttcgatgcttgagatcggcatgttcc
gattcgtctcctgctctcgtatcctcgacgcgtgtgtcgttcccttcgaaggtttcgtat
ctgtcaggtaaatcttcgaaccgtggcgaagaaatgggtaagagaattgatggaatcgtt
aggagcgtcgatgggaagatctctgacgcatcttctttccccgaagcttcatctgcgact
ccaaattcgaaggtgaggaagcacacaatttcagtatttgttggtgatgaaagcggaatg
attaataggattgcaggagtctttgcgaggagaggttacaatattgagagtcttgctgtt
ggtcttaacagagacaaggctctgttcactattgttgtttgtggaactgaaagggtgctt
cagcaggtcatcgagcaacttcagaagctcgttaatgttctaaaggttgaagatatctca
agtgagccgcaagtggagcgtgaactgatgcttgtaaaagtgaatgcacatccagaatcc
agagcagagatcatgtggctagttgacacattcagagctaaagttgtagatatcgcggaa
catgccttgactattgaggtaactggagatcctggaaaaatgattgctgtagaaagaaat
ttgaaaaagtttcagatcagagagattgtacggacaggaaagatagcactaagaagggaa
aagatgggtgcaactgctccattttggcgattttcagcagcatcctatccagatctcaag
aagcaagcacctgttagtgttcttcgaggtagcaaaaaagaagccgtgatccctcaaaat
gaaacaacagcagggggagatgtttatcccgttgagccaccttctgaccacatggtacat
cgtgttctcgacgcacactggggacttctctctgatgaggatacgagtggactacggtcg
catactctatctttgcttgtgaatgatgttccaggagttcttaatattgtgactggtgtt
ttcgctcgaaggggatacaatattcagagcttggctgtaggccacgctgaaaccaagggc
atttcacgcattacaacagttgttcctgcaacagatgaatcggtcagcaaattggtgcag
caacttaataaacttgtagatgtgcatgcggtccatgatctgactcatttgccatttgct
gaaagagaactgatgctgattaagattgccgtgaacgctgctgcgagaagagatgtccta
gacattgctagtattttcagggctaaagctgttgacgtatccgatcacacaattactttg
cagcttactggggatctagacaagatggttgcactgcaaaggttgttggagccctacggt
atatgcgaggttgcaagaaccggacgcgttgcattggctcgtgaatcgggagtggactcc
aagtatcttcgtggatactcctttcctttaactggttga

KEGG   Camelina sativa (false flax): 104791075
Entry
104791075         CDS       T05044                                 
Name
(RefSeq) acetolactate synthase, chloroplastic-like
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00650  Butanoate metabolism
csat00660  C5-Branched dibasic acid metabolism
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104791075
   00660 C5-Branched dibasic acid metabolism
    104791075
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104791075
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104791075
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     104791075
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 104791075
NCBI-ProteinID: XP_010515177
LinkDB
Position
6:complement(12558004..12560258)
AA seq 667 aa
MAAATTTSSSSIPFSAKPSSSKSPLPISRFTLPFSLNPNKSSSSSRRRGIKSTSLSISAV
LNTTTNVSTTTPPSKQTKPEKKKFVSRFAPDQPRKGADILVEALERQGVETVFAYPGGAS
MEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSTGKPGICIATSGPGATNLVSGLADAL
LDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIVEEAFFLAT
SGRPGPVLVDVPKDIQQQLAIPNWEQSMRLPGYMSRMPKPPEDSHLEQIVRLVSESKKPV
LYVGGGCLNSSEELGRFVELTGIPVASTLMGLGAYPCDDELSLHMLGMHGTVYANYSVEH
SDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMN
KVLENRAEELKLDFGVWRSELNEQKQMFPLSFKTFGEAIPPQYAIQVLDELTDGRAIIST
GVGQHQMWAAQFYKYKKPRQWLSSAGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIM
NVQELATIRVENLPVKILILNNQHPGMVIQWEARFYKANRAHTYLGNPAAEDEIFPNMLQ
FASACGIPAARVTKKAELREAIQKMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDVITE
GDGRTKY
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggcggcggcaacaacaacatcatcatcttcgatccccttctcagcaaaaccttcctca
tccaaatcaccattaccaatctccaggttcaccctcccattctccctaaacccaaacaaa
tcctcctcctcctcccgccgccgcggtatcaaatcaacctccctctccatctccgccgtc
ctcaacacaacaaccaatgtctcaaccaccactcctccatcaaaacaaaccaaacccgaa
aaaaaaaaattcgtctcccgatttgctccagatcagccacgcaaaggcgctgacatcctc
gtcgaagctttagaacgccaaggcgtagaaacagtcttcgcttacccaggaggtgcatca
atggagattcaccaagccttaactcgttcctcctcgatccgtaacgtccttccacgtcac
gaacaaggtggcgtgttcgcagctgaaggctacgctagatccacaggtaaaccaggtatc
tgtatagcaacctcaggtcctggagctacaaatctcgttagcggattagccgatgccttg
ttagatagtgttcctcttgtagcgatcacgggtcaagtccctcgtaggatgattggtact
gatgcgtttcaagaaactcccatcgttgaggtgacgcgttcgattactaaacataactat
cttgtgatggatgttgaagatattcctaggattgttgaggaagctttctttttagctacc
tctggtagacctggacctgttttggttgatgttcctaaagatatacagcagcagctcgcg
attcctaattgggaacagtctatgaggttacctggttatatgtctaggatgcctaaacct
ccggaggattctcatttggagcagattgttaggttggtttctgaatctaagaagcctgtg
ttgtatgttggtggtggttgtttgaattcgagtgaggagttgggtaggtttgttgaactt
acgggtatccctgttgcgagtacgttgatgggtcttggtgcttatccttgtgatgacgag
ttgtcgttgcatatgcttggcatgcacgggactgtgtatgcgaattactctgtggagcat
agtgatttgttgttggcttttggggtgaggtttgatgatcgtgtcacgggtaagcttgag
gcttttgctagtagggcgaagattgttcacattgatattgactcggctgagattgggaag
aataagactcctcatgtgtctgtgtgtggagatgttaagctggctttgcaagggatgaat
aaggttcttgagaaccgagctgaggagcttaagcttgattttggagtttggagaagtgag
ttgaacgaacagaaacaaatgttccctctgagcttcaagacttttggggaagctattcct
cctcagtatgcgattcaggttcttgatgagctgactgatgggagagccattataagcact
ggtgtcgggcaacatcaaatgtgggcggcgcagttttacaagtacaaaaaaccaaggcag
tggctatcatcagcaggccttggagctatgggttttggacttcccgctgctattggtgcg
tccgttgcgaatcctgatgcgattgtagtggatattgacggagatggaagcttcataatg
aatgtgcaagagctggccacaatccgggtggagaatctcccagtgaagatacttatacta
aacaaccagcatcctggcatggttattcaatgggaggctcggttctacaaagctaaccga
gctcacacatatcttggtaacccggcagcggaggacgagatattcccgaacatgctgcag
tttgcatcagcttgcggtattccagcggcgagggtgacaaagaaagcagagctccgagaa
gctattcagaaaatgctggataccccaggaccatacttgttggatgtgatatgtccgcac
caagaacatgtgttgccgatgatcccaagtggcggcactttcaatgatgtcataacggaa
ggagatggccggactaaatactga

DBGET integrated database retrieval system