KEGG   Camelina sativa (false flax): 104702118
Entry
104702118         CDS       T05044                                 
Name
(RefSeq) cytosolic sulfotransferase 18
  KO
K22321  aliphatic desulfoglucosinolate sulfotransferase [EC:2.8.2.38]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00966  Glucosinolate biosynthesis
csat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104702118
Enzymes [BR:csat01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.38  aliphatic desulfoglucosinolate sulfotransferase
     104702118
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 PIK3CG_ABD
Other DBs
NCBI-GeneID: 104702118
NCBI-ProteinID: XP_010416243
LinkDB
Position
7:23156998..23158127
AA seq 345 aa
MESETLTAVATVPNHEETKIESTEFEKNQQRYQDLISTFPHEKGWRVKEPLIEYGGYWWL
QPLLEGCIHAQEFFQARPGDFLICSYPKTGTTWLKALTFAIANRSRFDDSSNPLLKRNPH
EFVPYIEIDFPFFPDVDVLKDKGNTLFSTHVPYELLPESVVKSGCKMVYIWREPKDTFIS
MWTFIHKDRTDLGPVSNLEESFDMYCRGLCAYGPYLDHVLAYWKAYQQHPDRILFLNYET
MRADPLPYVKSLAEFMGYGFTAEEEENGVVEKVVSLCSFETLKNLEANKGEKDREDRPGV
YANSAYFRKGKVGDWTNYLTPEMAARIDGIMEAKFKGTGLLEHGK
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggaatcagaaaccctaaccgccgtggcgaccgtaccgaaccatgaagagaccaagata
gaatcaacagagttcgagaagaatcagcaacggtaccaagacctaatctccacgtttcct
cacgagaaaggctggagagtgaaagagcccctcatcgagtatggtggttactggtggcta
cagcctctcctagaaggttgtatacacgctcaagagttctttcaagcgcgaccaggtgac
ttcctcatctgtagctacccaaagacaggtaccacttggctcaaagccttgactttcgcc
atcgccaaccgatcccgcttcgacgattcctccaaccctctcctgaaacgtaaccctcac
gagtttgttccttacattgagatcgacttccctttcttccctgacgtagatgttctcaaa
gacaaaggcaacactctgttttcaactcatgtcccatacgagttgttacctgagtcggtt
gtgaaatcgggttgtaagatggtttacatctggagagagccaaaggacactttcatctcc
atgtggactttcattcacaaggacaggacagatcttggacctgtcagcaatcttgaggag
tcttttgatatgtactgtcgtggtctgtgtgcgtacggtccttaccttgatcatgtcctg
gcgtattggaaagcttaccaacaacatccagatcggattttgttcctcaactacgagact
atgagagctgatcctttgccttacgtgaagagtctggctgagtttatgggttatggattc
actgctgaggaagaggagaatggtgttgttgagaaagttgtgagtctttgcagcttcgag
acattgaagaatcttgaagctaacaaaggagagaaagacagagaggatcgtcctggcgtt
tatgcgaatagcgcgtatttcaggaaaggaaaggtgggagattggactaattatctgact
ccagagatggcagctcgtatcgatggcataatggaagcgaaatttaagggcaccggtttg
cttgaacatggtaagtga

DBGET integrated database retrieval system