KEGG   Camelina sativa (false flax): 104703063
Entry
104703063         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 2, chloroplastic-like
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104703063
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104703063
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     104703063
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 104703063
NCBI-ProteinID: XP_010417301
LinkDB
Position
7:28466299..28468568
AA seq 406 aa
MTAGAAALQTNIRPVKVPATFRAVSKQYPFRVRCAVGSPGNKRYNITLLPGDGIGPEVVS
IAKNVLRQAGSLEGVEFSFREMPIGGAALDLVGVPLPEETISAAKESDAVLLGAIGGYKW
DNNEKHLRPEKGLLQLRAALKVFANLRPATVLSQLVDASTLKREVAEGVDLMVVRELTGG
IYFGEPRGIKTNENGEEVGFNTEVYAAHEIDRIARVAFETARKRRGKLCSVDKANVLEAS
ILWRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRI
EDAVLVALNNGFRTGDIYSAGTKLVGCKEMGEEVLKSVDSQLPASV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgacggcgggggcggcggctctgcagacgaatatcagaccggtcaaggttccggctacc
tttagagctgtctccaaacaatatccctttagagtaagatgcgctgttggttcccctggg
aataaacgatacaacatcactctccttcccggtgacggcatcggtccggaggttgtctct
attgccaaaaatgtgcttcgccaagctggatctctcgaaggagttgaatttagcttccgg
gagatgcccattggaggagctgctttggatttggtcggagttcccttgccggaggagacc
atctcagctgctaaagaatcagatgcagtgcttcttggagccattggagggtacaaatgg
gataacaatgaaaaacatctgaggcctgagaagggtttacttcagcttcgtgcagctctc
aaagtctttgcaaatctgagacctgctacagttctttcacagttagtggatgcttccacc
ttgaagagagaggtagctgaaggtgttgatctaatggttgttagggagcttacaggaggt
atttactttggagagccaaggggcataaagaccaatgaaaatggcgaggaagttgggttt
aatactgaggtttatgctgctcacgagattgatagaattgctcgtgtggcctttgagact
gctcggaaacggcgtggcaagctttgttcagtcgacaaagctaatgtcttggaagcctca
attttatggaggaaacgagtaacagcattagcatctgaatatcctgatgttgagctgtca
catatgtatgttgacaatgccgcgatgcagcttgttcgtgacccaaaacagtttgacacc
atcgtcacaaacaacatttttggtgatatattatccgatgaagcttcaatgatcacagga
agcattggaatgctgccatctgctagtctcagtgattctggacctggactctttgaacca
atacatggttctgcacctgatattgctggacaggataaggcaaacccattggcaacgatt
cttagtgctgcaatgcttctgaaatacggacttggagaagaaaaggcagccaagagaatt
gaagacgcagttttggttgctctgaacaacggattcagaactggagacatttactccgca
ggaactaaactggttggctgcaaggagatgggagaggaggttctgaagtcagtagactcc
caacttccagcttctgtttaa

KEGG   Camelina sativa (false flax): 104708352
Entry
104708352         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 3, chloroplastic-like
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104708352
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104708352
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     104708352
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 104708352
NCBI-ProteinID: XP_010423205
LinkDB
Position
8:24392882..24394169
AA seq 222 aa
MIAHVAVVVPIDFSSVVDRIARVAFEIAKQRRGKLCSVDKASVLEGSILWRERATKMXSE
YPEVEVTHLLIDTAAMDLIRHPKEFDVILTGIMFGDILSDLAAVIPGSVGLLPSASFGDS
GLGIFEPIHGSAPKHYGKDTVNPLASVLSAVMLLRYGLKEENAAKRIEDAVFDVLDRGFR
TRDIHTHGTILVGCERMGQEILRSLDAKVDNRVLASTGSLVY
NT seq 669 nt   +upstreamnt  +downstreamnt
atgattgcgcatgtagccgttgttgtccccattgatttttcgagtgttgttgatcgtatt
gctcgtgtggcatttgagattgctaaacaacgccgcggtaaactttgctctgttgacaag
gcttcagtcttggaggggtcgatattgtggagggaaagagcaacgaaaatgtnctcagag
tatcctgaggttgaagtcacccatctactcattgacaccgctgcaatggatcttattcgc
cacccaaaagagtttgatgtcatcttgactgggattatgtttggtgatattctctctgat
cttgcggctgtgatccccggaagtgtaggattgcttccatctgcttcctttggtgattct
gggcttggaatctttgaacctatacatggctctgcacctaaacactatgggaaggacacg
gtgaatccattggcaagtgttctatcagctgtaatgcttttgagatacggtttgaaagaa
gaaaatgctgcaaagaggatagaagatgctgttttcgatgttcttgatcgtggattcaga
acacgtgatattcacactcatggaactatactggtaggttgcgagagaatggggcaggag
atactgagatccctggatgccaaagttgataacagagtcttagcctcaactggaagtttg
gtttattag

KEGG   Camelina sativa (false flax): 104713996
Entry
104713996         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 2, chloroplastic-like isoform X1
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104713996
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104713996
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     104713996
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 104713996
NCBI-ProteinID: XP_010429527
LinkDB
Position
9:34125816..34129444
AA seq 407 aa
MAAAAAAALQTNIRPVKVPATFRAVSKQSPFRVRCAVASPGNKRYNITLLPGDGIGPEVV
SIAKNVLRQAGSFEGVEFSFQEMPIGGAALDLVGVPLPEETISAAKESDAVLLGAIGGYK
WDNNEKHLRPEKGLLQLRAALKVFANLRPATVLSQLVDASTLKREVAEGVDLMVVRELTG
GIYFGEPRGIKTNENGEEVGFNTEVYAAHEIDRIARVAFETARKRRGKLCSVDKANVLEA
SILWRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMIT
GSIGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKR
IEDAVLVALNNGFRTGDIYSAGTKLVGCKEMGEEVLKSVDSQVPASV
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggctctgcagacgaatatcagaccggtcaaggttccggct
accttcagagctgtctcgaaacaatctccctttagagtaagatgcgctgttgcttcccct
gggaataaacgatacaacatcactctccttcccggtgacggcatcggtccggaggttgtc
tctattgccaaaaatgtgcttcgccaagctggatctttcgaaggagttgaatttagcttc
caggagatgcctattggaggagctgctttggatttggtaggagttcccttgccggaggag
accatctctgctgcaaaagaatcagatgcagtgcttcttggagccattggagggtacaaa
tgggataacaatgaaaaacatctgaggcctgagaagggtttacttcagcttcgtgcagct
ctcaaagtctttgcaaatctgagacctgctactgttctctcacagttagtggatgcttcc
accttgaagagagaggtagctgaaggtgttgatctaatggttgttagggagcttacagga
ggtatttactttggagagccaaggggtattaagaccaatgaaaatggtgaggaagttggg
tttaatactgaggtttatgctgctcacgagattgatagaattgctcgtgttgccttcgag
actgctcggaaacggcgtggcaagctttgttcagtcgacaaagctaatgtcttggaagcc
tcaattttatggaggaaacgagtaacagcattagcctctgaatatcctgatgttgagctg
tcacatatgtatgttgacaatgccgcaatgcagcttgttcgtgacccaaaacagtttgat
accatcgttacgaacaacatttttggtgatatattatccgatgaagcttcaatgatcaca
ggaagcattggcatgctgccatctgctagtctcagtgattcgggacctggactctttgaa
ccaatacatggttctgcacctgatattgctggacaggataaggcaaacccattggcaaca
attctcagtgctgcaatgcttctgaaatacggacttggagaagaaaaggcagccaagaga
attgaagacgcagttttggttgctctgaacaacggattcagaactggagacatttactcc
gcaggaactaaactggttggctgcaaggagatgggagaggaggttctgaagtcagtggac
tcccaagttccagcttctgtttaa

KEGG   Camelina sativa (false flax): 104734767
Entry
104734767         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase, chloroplastic-like isoform X1
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104734767
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104734767
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     104734767
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 104734767
NCBI-ProteinID: XP_010452712
LinkDB
Position
13:complement(3015686..3018008)
AA seq 414 aa
MAGVLSFHVISIKNSVALKPVTKQTIKRASVIRCAAYTPKKRYTIAVLPGDGIGNEVTPV
AVDALRLAGSLEGLELSFEELPIGGKALDLVGVPLPEETLTRAKQSDAILLGAAGWPKWD
DHPKHLKPITGLSQLRAGLDVFSNLRPVRVFPQLIGSTCLRQETVQGVDLMIIRELTGGI
YNAHPRGFTTNEQGDEVGFCTESYSSTEVDRIARVAFEIAKQRRGKLCSVDKASVLEGSI
LWRERVTKMSSEYPEVEVTHLLIETAAMDLIRHPKEFDVILTGIMFGDILSDLAAVIPGS
VGLLPSASFGDSGLGIFEPIHGSAPKHYGKDTVNPLASVLSAVMLLRYGLKEENAAKRIE
DAVFDVLDRGFRTRDIHTHGTILVGCKRMGQEILRSLDAKVDNRVLASTGSLVY
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcgggagttttgagtttccacgtcatcagtatcaagaactcggttgcgttgaagccc
gtcaccaaacagaccattaagagagcgtcagtgatcagatgcgccgcgtacacaccgaag
aaacggtacaccatcgctgtgcttcctggggatggcatcggcaacgaagtcacccctgtc
gctgtggacgcgcttcgtttagctggatcactcgaagggttagaattgagcttcgaggag
ttgccaataggaggtaaagctttagatctggtgggagtcccattaccagaggaaacgtta
acaagggcaaagcaatcagatgctattcttctcggagctgctggatggccgaaatgggat
gatcaccccaagcatttgaaacctataactgggttatcgcagcttcgtgcgggtcttgat
gtgttttccaacttgagacctgttagagtgttccctcagttgatcggttccacatgtctg
agacaagaaacagtacaaggggtcgatctaatgatcatccgggagcttactggcggtatt
tacaacgcacatcctcgtggttttactactaatgagcaaggtgatgaagtcgggttttgc
accgagtcctactcttcaactgaggttgatcgtattgctcgtgtggcatttgagattgct
aaacaacgccgtggtaaactttgctctgttgacaaggcttcagtcttggagggttcgata
ttgtggagggaaagagtaacgaaaatgtcctcagagtatcctgaggttgaagtgacccat
ctactcattgaaaccgctgcaatggatcttattcgccacccaaaagagtttgatgtcatc
ttgactgggatcatgtttggtgatattctctctgatcttgcggctgtgatccccggaagt
gtaggattgcttccatctgcttcctttggtgattctggtcttggaatctttgaacctata
catggctctgcacctaaacactatgggaaggacacggtgaatccattggcaagtgttcta
tcagctgtaatgcttttgagatacggattgaaagaagaaaatgctgcaaagaggatagaa
gatgctgttttcgatgttcttgatcgtggattcagaacacgtgatattcacactcatgga
actatactggtaggttgcaagagaatggggcaggagatactgagatccctggatgccaaa
gttgataatagagtcttagcctcaactggaagtttggtttattag

KEGG   Camelina sativa (false flax): 104735438
Entry
104735438         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 3, chloroplastic isoform X1
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104735438
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104735438
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     104735438
    1.1.1.-
     104735438
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 104735438
NCBI-ProteinID: XP_010453537
LinkDB
Position
13:6054847..6056954
AA seq 408 aa
MASFLQTNIRLSSNKIVPGKYTSLNNKYHAPSLIRCAAASPGKKRFNIALLPGDGIGPEV
ISVAKNVLQKAGSLEGLEFDFQEMPVGGAALDLVGVPMPEESFTAAKNSDAILLGAIGGY
KWDKNEKHLRPEMALFYLRRDLKVFANLRPATVLPQLADASTLKKEVAEGVDMMIVRELT
GGIYFGEPRGISINENGEEVGISTEIYAAHEIDRIARVAFETARKRRGKLCSVDKANVLD
ASVLWRKRVTALASEYPDVELSHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMI
TGSIGMLPSASLSESGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAK
RIEDAVMDALSRGFRTGDIYSPGNKLVGCKEMGAEVLKSVDAKVPATV
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcgtcgtttttgcaaacgaacatccgactaagttccaacaagatcgtccccggaaaa
tatacttctttgaataataagtatcatgcaccgtctctaattaggtgcgccgcagcttca
ccggggaaaaaacggtttaacatcgctctccttcccggtgacggcatcggtccagaagtt
atatctgttgctaagaatgtgcttcagaaagctggatctcttgaaggactggagtttgat
ttccaagagatgcctgtcggaggagcagccttggatttggttggagttcccatgccagag
gaatctttcacagctgctaaaaattctgatgctatacttcttggagctattggagggtat
aaatgggacaagaatgagaaacatctgagacctgagatggctttgttttacctacgaaga
gatctcaaagtctttgcaaatttaagacctgctacagttttgccacagttagctgatgct
tccacattgaagaaagaagtagcagaaggtgttgatatgatgattgtaagagagctcact
ggaggtatttattttggagagccaagaggaatatctattaatgaaaatggcgaagaagtc
ggcattagtacagagatctacgctgctcacgagatcgacagaattgctcgtgttgcgttt
gagactgctaggaaaaggcgcggcaagctgtgttctgtcgacaaagccaatgtgttggat
gcatcagtactgtggaggaaaagagtaacagcgttagcctctgaatatccagatgttgaa
ctatcacatatgtatgttgataatgctgcaatgcagcttatccgtgacccgaaacagttt
gacacaatcgtcaccaataacatttttggtgatatattatctgatgaagcttcaatgatc
actggaagcattggaatgcttccatctgctagtctcagtgaatcgggacctggactcttt
gaacctatacatggttctgcaccagatatagctggacaagacaaggcaaacccattggcc
actattctcagcgccgcaatgcttctgaaatatggacttggagaagaaaaagctgcaaag
aggattgaagacgcggtcatggatgctctgagcagagggttcagaactggagacatctac
tcccccggaaataaactggtgggatgcaaagaaatgggagcggaggtgctcaaatcagtg
gacgccaaagttccagctactgtttaa

KEGG   Camelina sativa (false flax): 104752167
Entry
104752167         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 2, chloroplastic
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104752167
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104752167
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     104752167
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 104752167
NCBI-ProteinID: XP_010472534
LinkDB
Position
16:24153807..24156260
AA seq 404 aa
MAAAALQTNIRPVKVPATFRAVSKQSPFRVRCAVASPGNKRYNITLLPGDGIGPEVVSIA
KNVLRQAGSLEGVEFSFQEMPIGGAALDLVGVPLPEETISAAKESDAVLLGAIGGYKWDN
NEKHLRPEKGLLQLRAALKVFANLRPATVLSQLVDASTLKREVAEGVDLMVVRELTGGIY
FGEPRGIKTNENGEEVGFNTEVYAAHEIDRIARVAFETARKRRGKLCSVDKANVLEASIL
WRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMITGSI
GMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRIED
AVLVALNNGFRTGDIYSAGTKLVGCKAMGEEVLKSVDSQVPASV
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggcggcggcggctctgcagacgaatatcagaccggtcaaggttccggctacgttcaga
gctgtctccaaacaatctccctttagagtaagatgcgctgttgcttcccctgggaataaa
cgatacaacatcactctccttcccggtgacggcatcggtccggaggttgtctctattgcc
aaaaatgtgcttcgccaagctggatctttggaaggagttgaatttagcttccaggagatg
cccattggaggagctgctttggatttggtcggagttcccttgccggaggagaccatctct
gctgcgaaagaatcagatgctgtgcttcttggagccattggagggtacaaatgggataac
aatgaaaaacatctgaggcctgagaagggtttacttcagcttcgtgcagctctgaaagtc
tttgcaaacctgagacctgctacagttctctcacagttagtggatgcttccaccttgaag
agagaggtagctgaaggtgttgatctaatggttgttagggagcttacaggaggtatttac
tttggagagccaaggggcataaagaccaatgaaaatggcgaggaagttgggtttaatact
gaggtttatgctgctcacgagattgatagaattgctcgcgttgccttcgagactgctcgg
aaacggcgtggcaagctttgttcagtcgacaaagctaatgtcttggaagcctcaatttta
tggaggaaacgagtaacagcattagcctctgaatatcctgatgttgagctgtcacatatg
tatgttgacaatgccgcgatgcagcttgttcgtgacccaaaacagtttgataccatcgtc
acgaacaacatttttggtgatatattatccgatgaagcttcaatgatcacaggaagcatt
ggaatgctgccatctgctagtctcagtgattcgggacctggactctttgaaccaatacat
ggttctgcacctgatattgctggacaggataaggcaaacccgttggcaacaattctcagt
gctgcaatgcttctgaaatacggacttggagaagaaaaggcagccaagagaattgaagac
gcagttttggttgctctgaacaacggattcagaactggagacatttactccgcaggaact
aaactggttggctgcaaggcgatgggagaggaggttctgaagtcagtggactctcaagtt
ccagcttctgtttaa

KEGG   Camelina sativa (false flax): 104769651
Entry
104769651         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 3, chloroplastic isoform X1
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104769651
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104769651
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     104769651
    1.1.1.-
     104769651
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 104769651
NCBI-ProteinID: XP_010492219
LinkDB
Position
20:6356278..6358373
AA seq 408 aa
MASFLQTNIRLSSNKIVPGKYTSLNNQYHAPSLIRCAAASPGKKRFNIALLPGDGIGPEV
ISVAKSVLEKAGSLEGLEFDFQEMPVGGAALDLVGVPMPEESFTAAKNSDAILLGAIGGY
KWDKNEKHLRPEMALFYLRRDLKVFANLRPATVLPQLADASTLKKEVAEGVDMMIVRELT
GGIYFGEPRGISINENGEEVGISTEIYAAHEIDRIARVAFETARKRRGKLCSVDKANVLD
ASVLWRKRVTALASEYPDVELSHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMI
TGSIGMLPSASLSESGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAK
RIEDAVMDALSRGFRTGDIYSPGNKLVGCKEMGAEVLKSVDAKVPATV
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcgtcgtttttgcaaacgaacatccgactaagttccaacaagatcgtccccggaaaa
tacacttccctaaataatcagtatcatgcaccgtctctaattaggtgcgccgcagcttca
ccggggaaaaaacggtttaacatcgctctccttcccggtgacggcatcggtccagaagtt
atatctgttgctaagagcgtgctcgagaaagctggatctcttgaaggactggagtttgat
ttccaagagatgcctgtcggaggagcagccttggatttggttggagttcccatgccagag
gaatctttcacagctgctaaaaattctgatgctatacttcttggagctattggagggtac
aaatgggacaagaatgagaaacatctgagacctgagatggctctgttttacctacgaaga
gatctcaaagtctttgcaaatttaagacctgctacagttttgccacagttagctgatgct
tccacattgaagaaagaagtagcagaaggtgttgatatgatgattgtaagagagctcact
ggtggtatttactttggagagccaagaggcatatccatcaatgaaaatggcgaagaagtc
ggcattagtacagagatctacgctgctcacgagatcgacagaattgctcgtgttgcgttt
gagactgctaggaaaaggcgtggcaagctttgttctgtcgacaaagccaatgtgttggat
gcatcagtactgtggaggaaaagagtaacagcgttagcctctgaatatccagatgttgaa
ctatcacatatgtatgttgataatgctgcaatgcagcttatccgtgaccccaaacagttt
gacacaatcgtcaccaataacatttttggtgatatattatctgatgaagcttcaatgatc
actggaagcattggaatgcttccatctgctagtctcagtgaatcgggacctggactcttt
gaacctatacacggttctgcaccagatatagctggacaagacaaggcaaacccattggct
actattctcagcgctgcgatgcttctgaaatatggacttggagaagaaaaagctgcaaag
aggattgaagacgcggtcatggatgctctgagcagagggttcagaactggagacatctac
tcccccggaaataaactggtgggatgcaaagaaatgggagcggaggtgctcaaatcagtg
gacgccaaagttccagctactgtttaa

DBGET integrated database retrieval system