KEGG   Camelina sativa (false flax): 104711489
Entry
104711489         CDS       T05044                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 3, chloroplastic
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104711489
   00280 Valine, leucine and isoleucine degradation
    104711489
   00290 Valine, leucine and isoleucine biosynthesis
    104711489
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104711489
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104711489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104711489
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104711489
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104711489
SSDB
Motif
Pfam: Aminotran_4 DUF3110 DUF4649 DUF4022 Nup188_C
Other DBs
NCBI-GeneID: 104711489
NCBI-ProteinID: XP_010426490
LinkDB
Position
9:20284523..20287393
AA seq 421 aa
MERAVISPSLNQNYLLCPSRAFSTRLHSFSSTRNLSPPSSSSSIKLQHSSSSSSVLLSVI
NGGASLTRCNAVLSNSSSTEVSEVADIDWDNIGFGLKPTDYMYVMKCNIDGEFSKGELQR
FGNIEVSPSAGVLNYGQGLFEGLKAYRKEDGNNILLFRPEENANRMRNGAERMCMPAPSV
EQFVEAVKETVLANKRWVPPPGKGSLYVRPLLMGTGAVLGLAPAPEYTFIIYVSPVGNYF
KEGVAPINLIVENDFHRATPGGTGGVKTIGNYAAVLKAQSIAKAKGYSDVLYLDCVYKRF
LEEVSSCNIFIVKDNVIATPEIKGTILPGITRKSIIDVARTQGFQVEERNVTVDELLEAD
EVFCTGTAVVVSPVGSVTYKGKRVSYGEGTFGTVSKQLYTVLTSLQMGLIEDNMNWTVNL
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggagagagcagtaatctccccgagtcttaatcaaaattacctactttgtccttcacgc
gccttctccacgcgcctccactctttctcctctactcggaacttatcgccgccgtcatct
tcttcctccatcaagcttcagcattcttcgtcttcttcctctgtattgttaagtgtcatc
aatggtggtgcctctcttactcgatgcaacgctgtgctctccaattcttccagtacggaa
gtgtctgaagtagccgacatagattgggataacattggatttgggcttaagccgactgat
tacatgtatgtgatgaaatgcaacatcgatggagagttctctaaaggtgaattgcaacgt
tttggaaacattgaagtcagcccttctgctggtgtactcaactatggacagggattgttt
gaagggctaaaagcttacagaaaggaagatggtaataatatcctcctcttccgtcctgag
gagaatgcaaaccgtatgagaaatggtgctgagaggatgtgtatgcctgctccatccgtt
gagcagtttgtcgaagctgtgaaagaaactgtattagcaaacaaacgttgggttccacct
ccaggtaaaggttccttatatgtgagaccgttgcttatggggacaggagctgttcttggt
cttgcacctgcaccagaatatactttcattatctatgtttcgcctgtcgggaactacttc
aaggaaggtgtggcaccaatcaatttgattgtggaaaatgattttcaccgtgcaactcct
ggtggtaccggaggtgttaaaaccattggcaactatgctgcagtactgaaggcacagtcg
attgcgaaagctaaaggatattctgatgttttgtatcttgattgcgtttacaaaagattt
cttgaagaggtctcgtcttgcaatatattcatcgtaaaggataatgtgattgctactcct
gaaataaaaggaaccattttaccagggattacgcggaaaagtataatcgacgtggctcga
acgcaagggtttcaggtggaggaacggaatgtgacagtggatgaattattagaagcagac
gaggttttctgcacagggactgctgtggttgtctctccagttggaagtgttacttacaaa
ggcaaaagagtgtcttacggagaaggtacctttggaactgtgtcgaagcaactctacacc
gtcctgacaagcttgcagatgggtttgattgaagacaacatgaattggactgtgaatctg
agttga

KEGG   Camelina sativa (false flax): 104727240
Entry
104727240         CDS       T05044                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 5, chloroplastic-like
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104727240
   00280 Valine, leucine and isoleucine degradation
    104727240
   00290 Valine, leucine and isoleucine biosynthesis
    104727240
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104727240
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104727240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104727240
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104727240
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104727240
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 104727240
NCBI-ProteinID: XP_010444596
LinkDB
Position
11:48717305..48719996
AA seq 419 aa
MERGGVISGGFHQNYIPYPSRAAASTTRLHYPFSSIRNSPSSSLRIRPCSISSSFIIIHE
VSRNRCDAVSSNSYSTDVTELAEIEIDWDKIDFGLKPTDYMYSMRCSRGGDFSNGQLEPF
GNIEVNPSAAVLNYGQGLFEGLKAYRKQDGNILLFRPEENAIRMRNGADRMCMPSPTVQQ
FVEAVKTTVLANKRWIPPPGKGSLYIRPLLMGTGAVLGLAPAPEYTFLIFVSPVGNYFKE
GVAPINLIVESEFHRATPGGTGGVKTIGNYAAVLKAQSIAKAKGYSDVLYLDCVHNRYLE
EVSSCNIFIVKDNVISTPEIKGTILPGITRKSIIEVARSQGFKVEERNVTVDELVEADEV
FCTGTAVVLSPVGSITYKSQRFSYGEDGFGTVSKQLYTSLTSLQMGLTEDNMNWTVQLS
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggagagaggcggcgtaatctcaggaggttttcatcaaaattacatcccatatccttca
cgcgccgccgcttccaccacgcgcctccactaccctttctcctccatcagaaactcgccg
tcttcctctctcaggattcgtccttgttccatctcttccagtttcatcatcattcatgaa
gtttcccgtaatcgatgcgacgccgtgtcctctaattcttacagcaccgatgtgactgaa
ttagccgaaattgaaattgattgggacaagatcgattttggtcttaagcctacggattac
atgtactccatgagatgtagccgtggtggtgatttctctaatggtcaattggaaccattt
ggcaacattgaggttaacccttcagctgctgtcctcaactacggacaaggtttgtttgaa
ggtcttaaggcttacagaaaacaagacggtaatatactcctcttccgtcccgaggagaac
gccatccgaatgaggaacggtgctgacagaatgtgcatgccttctccaaccgtccaacag
tttgttgaggctgtgaaaacaactgtattagctaacaaacgctggattccacctccaggt
aaaggatcattatacataaggccattgctaatgggaactggagctgttcttggccttgct
cctgctcctgaatacactttccttatcttcgtttctcctgtcgggaactacttcaaggaa
ggtgtggcgccgatcaacttgattgttgaaagtgaattccatcgtgcaactcctggcggt
actggaggtgttaaaaccattggtaattatgctgcagtcttgaaggcacagtcgattgcg
aaagctaaagggtattctgatgttttatatcttgattgcgttcacaacagatatctcgag
gaggtttcatcttgcaatattttcattgtgaaggataatgtgatctctactcctgaaatc
aaaggaaccatcttgcctggaattacccggaagagtattatcgaagtggctcgtagccaa
ggtttcaaggtggaggaacgaaatgtgacagttgatgaattggtagaagcggatgaggtt
ttctgcacaggaacggctgtcgttttatctccggtcggaagcattacttacaaaagccaa
aggttttcttatggagaagatggctttggaactgtctcgaaacagctgtacacttccttg
acgagcctccaaatgggtctaaccgaagataacatgaactggactgttcagttgagttaa

KEGG   Camelina sativa (false flax): 104739613
Entry
104739613         CDS       T05044                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 1, mitochondrial-like isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104739613
   00280 Valine, leucine and isoleucine degradation
    104739613
   00290 Valine, leucine and isoleucine biosynthesis
    104739613
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104739613
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104739613
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104739613
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104739613
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104739613
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 104739613
NCBI-ProteinID: XP_010458335
LinkDB
Position
14:4394481..4397297
AA seq 388 aa
MALRRCIPPSSTTSTNYLSKIIQIWGFRMHGTKAAASVVEEHVSEAEREDEEYADVDWDN
LGFSLVRTDYMFATRSCREGNFEQGYLSRYGNIELNPAAGILNYGQGLIEGMKACRREDG
RVLLFRPELNAMRMKIGAERMCMHSPSVQHFIEGVKQTVLANRRWVPPPGKGSLYLRPLL
FGSGASLGVAAAPEFTFLVFGSPVQNYFKEGTAALNLYVEEVIPRAYLGGTGGVKAISNY
GPVLEAMRRAKSRGFSDVLYLDAETGKNIEEVSASNIFLVKENTIVTPATNGTILGGITR
KSVIEISLDLGYKVEERSVAVEELKEAREVFCTGTATGVASVGSITFQNTRTEYKVGDAH
VTQQLRSILVGIQTGSIQDTKDWVMEIA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggctcttcgtcgctgcatacctccatcttcaacaacttcaactaattatctctccaag
ataatacagatctggggatttcgtatgcatgggaccaaggcagcagcttctgttgtagaa
gaacatgtctcggaggcagaacgtgaggatgaagagtatgctgatgttgattgggacaat
ctcggattcagtcttgtacggacagattacatgttcgccaccagaagttgcagagaggga
aacttcgaacagggttaccttagccgttacggcaacatcgagctaaaccctgctgctgga
attctcaactatggccagggactaatcgaggggatgaaagcgtgcagacgagaagacggt
agggttcttctcttccgtccagagctaaacgcgatgcgtatgaagataggagctgagaga
atgtgtatgcattctccttctgttcaacactttattgaaggtgttaagcagaccgttctt
gctaacaggcgttgggttcctcctcctggaaaaggctcattgtatcttagaccgttgttg
tttggaagcggagcaagcttgggtgtggctgcagcgccagaattcacgtttcttgtgttt
ggctctcctgttcaaaactattttaaggaaggcacagcggcgttgaacctgtatgtggag
gaggtgattccacgcgcctatcttggaggtactggtggcgtaaaggcaatttcaaattac
ggtccagtgcttgaggcgatgagaagagcgaaatcaagagggttttcggatgttttgtat
cttgatgcagagactgggaagaacatagaagaagtctctgcttctaatatattccttgtg
aaggagaatacaatagtgactccagctactaacgggacaattctaggagggatcacgcgt
aagagcgtcatcgaaatctcccttgaccttggttacaaggtggaagaacgaagcgttgcg
gttgaagaactgaaggaagcaagagaagtattctgcactggaactgccactggggttgct
tctgttggaagcatcacatttcagaacacaaggactgagtacaaagtgggagatgcgcat
gttacacagcaacttcgatctattctggtgggaatacaaactggttctatccaagacacc
aaggattgggttatggagattgcctaa

KEGG   Camelina sativa (false flax): 104739614
Entry
104739614         CDS       T05044                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 1, mitochondrial-like isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104739614
   00280 Valine, leucine and isoleucine degradation
    104739614
   00290 Valine, leucine and isoleucine biosynthesis
    104739614
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104739614
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104739614
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104739614
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104739614
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104739614
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 104739614
NCBI-ProteinID: XP_010458339
LinkDB
Position
14:4398584..4401377
AA seq 395 aa
MRVQLISSYYMALRRCIPQSSTYYLSKIIQIRGFRMHGTKAATSVVEEHVSDAEREDEEY
ADVDWDNLGFSLVRTDYMFATRSCSEGNFEQGYLSRYGNIELNPAAGILNYGQGLIEGMK
ACRGEDGKVLLFRPEQNAMRMKIGAERMCMHSPSVQHFIEGVKQTVLANRRWVPPPGKGS
LYLRPLLFGSGASLGVAAAPEYTFLVFGSPVQNYFKEGTAALNLYVEEVIPRAYLGGTGG
VKAISNYGPVLEAMRRAKSRGFSDVLYLDAETGKNIEEVSASNIFLVKENSIVTPTTNGT
ILEGITRKSVIEIALDLGYKVEERTVAVEELKEAREVFCTGTATGVASVGSITFQNTRTE
YKVGDALVTQQLRSILVGIQTGSIQDTKDWVMEIA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcgcgtacaactaatttcttcatactacatggctcttcgtcgctgcatacctcaatct
tcaacttattatctctccaagataatacagatccgggggtttcgtatgcatgggaccaag
gcagcaacttctgttgtagaagaacatgtctcggacgcagaacgtgaggatgaagagtat
gctgatgttgattgggacaacctcggattcagtcttgtacggacagattacatgttcgcc
accagaagttgtagcgagggaaacttcgaacagggttaccttagccgttacggcaacatc
gagctaaaccctgctgctggaattctcaactatggccaggggctaatcgaggggatgaaa
gcgtgcagaggagaagacggtaaggttcttctcttccgtccagagcaaaacgccatgcgt
atgaagataggagctgagagaatgtgtatgcattctccttctgttcaacactttattgaa
ggtgttaagcagaccgttcttgctaacaggcgttgggttcctcctcctggaaaaggctcg
ttgtatctccgaccgttgttgttcggaagcggagcaagcttaggtgtggctgcagcacca
gagtacacgtttcttgtgtttggctcccctgttcaaaactattttaaggaaggcacagcg
gcgttgaacctgtacgtggaggaggtgattccacgtgcctatcttggaggaactggtggc
gtaaaggcaatttcaaattacggtccagtgcttgaggcgatgagaagagcgaaatcaaga
gggttttcggatgttttgtatcttgatgcagagactgggaagaacatagaagaagtctct
gcttctaatatattccttgtgaaggagaattcaatagtgactccaactactaacgggaca
attctagaagggatcacgcgtaagagtgtcatcgaaatcgcccttgaccttggttacaag
gtggaagaacgaaccgttgccgttgaagaactgaaggaagcaagagaagttttctgcact
ggaactgccactggggttgcttctgttggaagcatcacgtttcagaacacaaggactgag
tacaaagtgggagatgcgcttgttacacagcaacttcgatctattctggtgggaatacaa
actggttctatccaagacactaaggattgggttatggagattgcctaa

KEGG   Camelina sativa (false flax): 104739616
Entry
104739616         CDS       T05044                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 2, chloroplastic-like isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104739616
   00280 Valine, leucine and isoleucine degradation
    104739616
   00290 Valine, leucine and isoleucine biosynthesis
    104739616
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104739616
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104739616
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104739616
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104739616
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104739616
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 104739616
NCBI-ProteinID: XP_010458344
LinkDB
Position
14:4407415..4409708
AA seq 388 aa
MIKAFSSLRKSLVLPLHLHIRMLQTFAKYNAQAATALREERKRPVYQNGDDEYVDLDWDN
LGFGLTPADYMYVMKCSKDGAFTEGELSPYGNIQLSPSAGVLNYGQAVYEGTKAYRKENG
KLLLFRPDHNAIRMKLGAERMLMPSPSVDQFVNAVKQTALANKRWVPPSGKGTLYIRPLL
MGSGPILGLGPAPEYTFIIYASPVGNYFKEGMAALNLYVEEEYVRTAPGGAGGVKSITNY
APVLKALSRAKSLGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITR
KSIMEIASDQGYQVVEKAVHVDEVMDADEVFCTGTAVVVAPVGSITYQDKRVEYKTGDES
VCQKLRSILVSIQTGLTEDNKGWVTNIN
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgatcaaagccttctcatctctacgcaaaagtctagttcttcctcttcatttacatatt
cgtatgctacaaactttcgctaagtacaacgcacaagctgccacggccttgcgagaagag
cgtaagagacctgtttatcaaaatggagatgatgagtatgtggatttggattgggacaat
ctcgggtttggtctaacgccagctgattacatgtatgtcatgaaatgctcaaaagacggt
gcatttactgaaggagaacttagtccctatgggaatattcagctgagtccttctgctgga
gtcttaaactatggacaggcggtatatgaaggtacaaaagcatacaggaaagaaaatggg
aagcttcttctgtttcgcccggatcacaatgctatccgaatgaagcttggcgctgaacgg
atgctcatgccttctccttctgttgatcagtttgttaatgcagttaaacaaaccgctctc
gccaacaaacgttgggttcctccttcagggaaagggactttgtatatcaggcctttgttg
atgggaagtggtcctattcttggtttaggccctgcacctgaatatacattcattatctat
gcatctccagttggtaactacttcaaggaagggatggctgctcttaacctctatgttgag
gaagagtatgtccgtacagctcctggtggagctggaggggtcaagagcatcacaaattat
gccccagttttgaaagcactgagcagagccaagagcctggggttttcagacgttctttat
cttgattctgtcaagaaaaagtatctagaggaggcttcttcttgcaatgtctttgttgtg
aagggtcggacaatctcaactcctgcaactaatggtacaattcttgaggggattacacgg
aaaagtataatggagatcgcaagtgatcaaggttatcaggtagtagagaaggcagtacat
gtggatgaagtaatggatgcagatgaagtcttttgtaccggaactgctgtagtagttgct
cctgtgggttctataacatatcaggacaaaagagtggagtataaaaccggggatgaatct
gtctgccagaaactgcgttccatccttgtctctatccagacaggattgactgaagacaac
aagggatgggtcacaaatatcaactga

KEGG   Camelina sativa (false flax): 104742544
Entry
104742544         CDS       T05044                                 
Name
(RefSeq) putative branched-chain-amino-acid aminotransferase 7
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104742544
   00280 Valine, leucine and isoleucine degradation
    104742544
   00290 Valine, leucine and isoleucine biosynthesis
    104742544
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104742544
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104742544
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104742544
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104742544
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104742544
SSDB
Motif
Pfam: Aminotran_4 DUF4022
Other DBs
NCBI-GeneID: 104742544
NCBI-ProteinID: XP_010461859
LinkDB
Position
14:complement(26511460..26513803)
AA seq 356 aa
MAPCAHSSSSPLLTSKEEEKYADVKWDELEFALVPTDYMYVAKYKQGESFSEGEIVPYGD
ISISPCAGILNYGQGLFEGLKAYRTEDGRITLFRPEENALRMQIGADRLCMTPPSPDQFV
EAVKQTVLANNKWVPPPGKGALYIRPLLIGTGAILGVASAPEYTFLIYTSPVGNYHKASS
GLNLKVDDKHRRAHSGGTGGVKSCTNYSPVLKSLVEAKSSGFSDVLFLDAATGKNIEEIS
TCNIFILKGNIVSTPPTSGTILPGITRKTISELARDIGYQVQERDVSIDELLEAEEVFCT
GTAMVLKAVDTVTFDDKNIKYKTGEEALSTKLHLMLTNIQTGVVENNKGWMVDISS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggctccttgtgcgcattcttcctcatcacctcttcttacaagtaaagaagaagaaaaa
tatgcggatgtgaaatgggacgagcttgaattcgctttggttccaacagattatatgtat
gtggcgaaatacaaacaaggagagagcttttcagaaggagaaattgttccttatggggat
atttcaataagcccttgtgctgggattctcaattatggccagggactatttgaaggtctc
aaggcgtacaggacagaagatggacggatcacacttttcaggcctgaagaaaacgctctt
cgtatgcaaataggtgcggataggctttgtatgacacctccttctccggaccaattcgta
gaagcggttaagcaaacggtgcttgccaacaacaaatgggtacctcctcccggtaaagga
gctttgtatattaggcctctactcataggtactggtgctatccttggagtagcttcagca
cctgaatatacgttcctcatttacacatctcccgttggaaattatcacaaggcaagttca
ggcttgaacctcaaagttgatgataagcatcgccgagcccactccggtggaacagggggt
gtgaagagttgcacaaactattctccagttctaaaatctttggttgaagcaaaatcatcg
ggtttctctgatgtcttgttcctggacgcggcgactggtaaaaacatcgaagagatttct
acttgtaacatctttattctcaagggaaacattgtgtccactccaccaacttcaggaacc
attttaccaggaatcacaaggaaaactataagcgagctagctcgtgatattggctaccag
gttcaagaacgggatgtttctattgatgagctactcgaggcagaagaagttttctgtaca
gggactgcaatggtccttaaagctgttgacaccgtgaccttcgatgacaaaaatataaaa
tacaagacaggagaagaggcattgtctacgaagcttcatttgatgttaaccaatattcaa
actggagttgttgaaaataacaaaggttggatggtggatatcagtagttga

KEGG   Camelina sativa (false flax): 104742545
Entry
104742545         CDS       T05044                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 6-like
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104742545
   00280 Valine, leucine and isoleucine degradation
    104742545
   00290 Valine, leucine and isoleucine biosynthesis
    104742545
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104742545
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104742545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104742545
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104742545
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104742545
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 104742545
NCBI-ProteinID: XP_010461861
LinkDB
Position
14:complement(26521336..26523601)
AA seq 357 aa
MAPSSSPLRTTSKADEKYANVRWEELGFALTPTDYMYVAKCRQGESFSQGKILPYGDISI
SPCSPILNYGQGLFEGLKAYRTEDDRIMIFRPDQNALRMQAGAERLCMTSPSLELFVDAV
KQTVLANKKWVPPPGKGTLYIRPLLIGSGDTLGVAPAPENTFLIYASPVRDYHKVSSGLD
LKVDHKHHRAHSGGTGGVKSCTNYSPVVKSLLEAKSSGFSGVLFLDAATGRNIEELSACN
IFIVKGNIVSTPPTSGTILPGVTRKSISELARDIGYQVQERDVSVDELLEAEEVFCTGTA
VVVTAVETVTFHDKKVKYRTGEASLSRKLRSMLTNIQMGIVEDKKGWMVEIDRYQGW
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggctccttcttcatcacctcttcgtactacaagtaaagcagatgagaagtatgccaat
gtgagatgggaagagcttggatttgctctgactccaacagattacatgtatgtagccaaa
tgcagacaaggtgagagcttttcacaaggaaagatccttccttatggggatatttcaatc
agcccttgttctccgattctcaattatggccagggactatttgaaggtctcaaagcttac
aggacagaagacgaccggattatgattttcaggcctgaccaaaacgctcttcgcatgcaa
gctggtgcggagaggctttgtatgacgtccccttctctggagctattcgttgatgcagtt
aagcaaactgtgcttgcaaacaagaaatgggttcctcctccgggtaaaggaactttgtat
ataaggcctctgctaattgggagcggtgatacccttggagtagctccagcacctgaaaac
acatttctcatatatgcatctccagtaagagattaccacaaggtgagctcaggcttggac
ctcaaagttgatcataagcatcaccgagcccattcaggtggaacaggtggtgtcaagagc
tgcacaaattattctccagttgtgaaatcgttgcttgaagcaaagtcatcgggtttctct
ggtgtcctgttcctggacgcggcaacaggtagaaacatcgaagagcttagtgcttgtaac
atcttcattgtcaagggaaacattgtgtccacaccaccaacttcaggaaccattttacct
ggagtcacaaggaaaagcataagtgagctagctcgtgatattggctaccaggttcaagaa
cgcgatgtttctgtggatgagctactagaggcagaagaagttttctgcacagggactgca
gtggtggttacagctgttgaaactgtgaccttccatgacaagaaggtaaaatacaggaca
ggagaagcatcgctgtctaggaagcttcgctcgatgttaaccaatattcagatgggcatt
gttgaagataagaaaggttggatggtggaaatcgatcgttatcaaggctggtga

KEGG   Camelina sativa (false flax): 104744239
Entry
104744239         CDS       T05044                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 5, chloroplastic-like
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104744239
   00280 Valine, leucine and isoleucine degradation
    104744239
   00290 Valine, leucine and isoleucine biosynthesis
    104744239
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104744239
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104744239
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104744239
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104744239
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104744239
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 104744239
NCBI-ProteinID: XP_010463562
LinkDB
Position
2:28216170..28218633
AA seq 418 aa
MERSGVISGGFHQNYILYPLRAAASTTRLHYPFSSIRNSPSSSLRIRPCSITSSFIIHEV
SRNRCDAVSSNSYSTDVTELAEIEIDWDKIDFGLKPTDYMYTMRCSRGGDFSNGQLQPFG
NIEVNPSAAVLNYGQGLFEGLKAYRKQDGNILLFRPEENAIRMRNGAERMCMPSPTVEQF
VEAVKTTVLANKRWIPPPGKGSLYIRPLLMGTGAVLGLAPAPEYTFLIFVSPVGNYFKEG
VAPINLIVETEFHRATPGGTGGVKTIGNYAAVLKAQSIAKAKGYSDVLYLDCVHNRYLEE
VSSCNIFIVKDNVISTPEIKGTILPGITRKSIIEVARSQGFKVEERSVTVDELVEADEVF
CTGTAVVLSPVGSITYKSQRFSYGEDGFGTVSKQLYTSLTSLQMGLTEDNMNWTVQLS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggagagaagcggcgtaatctcaggtggttttcaccaaaattacatcctatatccttta
cgcgccgccgcttccacgacgcgcctccactaccctttctcctccatcagaaactcgccg
tcttcctctctcaggattcgtccttgttccattacttccagtttcatcattcatgaagtt
tcccgtaatcgatgcgacgccgtttcctctaattcttacagcaccgatgtgactgaacta
gccgaaattgaaattgattgggacaagatcgattttggtcttaaacctacggattacatg
tacaccatgagatgtagccgtggtggcgatttctctaatggtcaattgcaaccttttggt
aacattgaggttaacccttcagctgctgttctcaactatggccaaggtttgtttgaaggt
cttaaggcttacagaaaacaagatggtaatattctcctcttccgtcccgaggagaatgca
atacgaatgaggaacggtgctgaaagaatgtgcatgccttctccaaccgtcgaacagttt
gttgaggctgtgaaaacaactgtattagcaaacaaacgctggattccacctccaggtaaa
ggatcattatacataaggccattgctaatgggaactggagctgttcttggccttgctcct
gctcctgaatacactttccttatctttgtttctcctgtcgggaactacttcaaggaaggt
gtggcgccgatcaacttgattgttgaaactgaattccatcgtgcaactcctggcggtact
ggaggtgttaaaaccattggtaattatgctgcagtgttgaaggcacagtcaattgcgaaa
gctaaagggtattctgatgttttatatcttgattgcgttcacaacagatatctcgaggag
gtttcatcttgtaatattttcattgtgaaggataatgtgatctctactcctgaaatcaaa
ggaaccatcttgcctggaattacccggaagagtattatcgaagtggctcgtagccaaggt
ttcaaggtggaggaacgaagtgtgacagttgatgaattggtagaagcggatgaggttttc
tgcacaggaacggctgtcgttttatctcccgtcggaagcattacttacaaaagccaaagg
ttttcttatggagaagatggctttggaactgtctcgaaacagctgtacacttccttgacg
agcctccaaatgggtctgaccgaagataacatgaactggactgttcagttgagttaa

KEGG   Camelina sativa (false flax): 104755218
Entry
104755218         CDS       T05044                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 1, mitochondrial-like isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104755218
   00280 Valine, leucine and isoleucine degradation
    104755218
   00290 Valine, leucine and isoleucine biosynthesis
    104755218
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104755218
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104755218
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104755218
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104755218
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104755218
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 104755218
NCBI-ProteinID: XP_010475866
LinkDB
Position
17:4193079..4195829
AA seq 388 aa
MALRRCLPQSSTTSTNYLSKIIQIWGFRMHVTKAAASVVEEHVSEAEREDEEYADVDWDN
LGFSLVRTDYMFATRSGSEGNFEQGYLSRYGNIELNPAAGILNYGQGLIEGMKACRGEDG
KVLLFRPEQNAMRMKIGAERMCMHSPSVQHFIEGVKQTVLANRRWVPPPGKGSLYIRPLL
FGSGASLGVAPAPEYTFLVFGSPVQNYFKEGTAALNLYVEEVIPRAYLGGTGGVKAISNY
GPVLEAMRRAKSRGFSDVLYLDAETGKNIEEVSASNIFLVKENSIVTPATNGTILEGITR
KSVIEIALDLGYKVEERTVAVEELKEAREVFCTGTATGVASVGSITFQNTRTEYKVGDAH
VTQQLRSILVGIQTGSIQDTKDWVMEIA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggctcttcgtcgctgcctacctcaatcttcaacaacttcaactaattatctctccaag
ataatacagatctggggatttcgtatgcatgtgaccaaggcagcagcttctgttgtagaa
gaacatgtctcggaggcagaacgtgaggatgaagagtatgctgatgttgattgggacaac
ctcggattcagtcttgtacggacagattacatgttcgccaccagaagtggtagcgaggga
aacttcgaacagggttaccttagccgttacggcaacatcgagctaaaccctgctgctgga
attctcaactatggccaggggctaatcgaggggatgaaagcgtgcagaggagaagacggt
aaggttcttctcttccgtccagagcaaaacgccatgcgtatgaagataggagctgagaga
atgtgtatgcattctccttctgttcaacactttattgaaggtgttaagcagaccgttctt
gctaacaggcgttgggttcctcctcctggaaaaggctcattgtatatcagaccgttgttg
tttggaagcggagcaagcttgggtgtggctccagcaccagagtacacgtttcttgtgttc
ggctcccctgttcaaaactattttaaggaaggcacagcggcgttgaacctttatgtggag
gaggtgataccacgcgcctatctaggaggtactggtggcgtaaaggcaatttcaaactac
ggtccagtgcttgaggcgatgagaagagcgaaatcaagagggttttcggatgttttgtat
cttgatgcagagactgggaagaacattgaagaagtctctgcttctaatatattccttgtg
aaggagaattcaatagtgactccagctactaacgggacaattctagaagggatcacacgt
aagagcgtcatcgaaatcgcccttgacctcggttacaaggtcgaagaacgaaccgttgcg
gtcgaagaactgaaggaagcaagagaagttttctgcactggaactgccactggggttgct
tctgttggaagcatcacatttcagaacacaaggactgagtacaaagtgggagatgcgcat
gttacacagcaacttcgatctattctggtgggaatacaaactggttctatccaagacacc
aaggattgggttatggagattgcctaa

KEGG   Camelina sativa (false flax): 104755220
Entry
104755220         CDS       T05044                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 2, chloroplastic isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat00280  Valine, leucine and isoleucine degradation
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
csat01240  Biosynthesis of cofactors
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104755220
   00280 Valine, leucine and isoleucine degradation
    104755220
   00290 Valine, leucine and isoleucine biosynthesis
    104755220
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104755220
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104755220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104755220
Enzymes [BR:csat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     104755220
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class IV
   104755220
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 104755220
NCBI-ProteinID: XP_010475868
LinkDB
Position
17:4202598..4207890
AA seq 388 aa
MIKAISSLRKSLVLPLHLHIRMLQTFAKYNAQAATALRDERKKPVYQNGDDEYVDLDWDN
LGFGLTPADYMYVMKCSKDGAFTEGELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKENG
KLLLFRPDHNAIRMKLGAERMLMPSPSVDQFVNAVKQTALANKRWVPPSGKGTLYIRPLL
MGSGPILGLGPAPEYTFIIYASPVGNYFKEGMAALNLYVEEEYVRAAPGGAGGVKSITNY
APVLKALSRAKSLGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITR
KSIMEIASDQGYQVVEKAVHVDEVMDADEVFCTGTAVVVAPVGSITYQDKRVEYKTGDES
VCQKLRSILVSIQTGLTEDNKGWVTNIN
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgatcaaagccatctcatctctacgcaaaagtctggttcttcctcttcatttacatatt
cgtatgctacaaactttcgctaagtacaacgcacaagctgccacggccttgagagatgag
cgtaagaaacctgtttatcaaaatggagatgatgagtatgtggatttggattgggataat
ctcgggtttggtctaactccagctgattacatgtatgtcatgaaatgctcaaaagacggt
gcatttactgaaggagaacttagtccttacgggaatatacagctgagtccttctgctgga
gtgttaaactatggacaggcaatatatgaaggtacaaaagcatacaggaaagaaaatggg
aagcttcttctgtttcgcccggaccacaatgctatccgaatgaagcttggcgctgaacga
atgctcatgccttccccttctgttgatcagtttgttaatgcagttaaacaaaccgctctc
gccaacaaacgttgggttccaccttcagggaaagggactttgtatattaggcctctgttg
atgggaagtggtcctattcttggtttaggccctgcacctgaatatacgttcattatctat
gcatctccagttggtaactacttcaaggaagggatggctgctcttaacctctatgttgag
gaagagtatgtccgtgcagctcctggtggagctggaggggtcaagagtatcacaaattat
gccccagttttgaaagcactgagcagagccaagagcctggggttttcagacgttctttac
ctcgattctgtcaagaagaaatatctagaggaggcttcttcttgcaatgtctttgttgtg
aagggtcggacaatctcaactcctgcaactaatggtacaattcttgaggggattacgcgg
aaaagtataatggagatcgcaagtgatcaaggttatcaggtagtagagaaggcagtacat
gtggatgaagtaatggatgcagatgaagtcttttgtaccggaactgctgtagtagttgct
cctgtgggttctataacatatcaggacaaaagagtagagtataaaaccggggatgaatct
gtctgccagaaactgcgttccatccttgtctctatccagacaggattgactgaagacaac
aagggatgggtcacaaatatcaactga

DBGET integrated database retrieval system