KEGG   Camelina sativa (false flax): 104712541
Entry
104712541         CDS       T05044                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104712541
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104712541
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     104712541
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 104712541
NCBI-ProteinID: XP_010427764
LinkDB
Position
9:27351292..27354459
AA seq 591 aa
MAAATSSIAPSLSCPSPCSSSKTLRSSKARASLALPNIGFLSSSSKSLRSLTATVAGNGV
GSSLAARMVSSSAVKAPMSLDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGVK
QIGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSRSFEEARAAGFTEESGTLGDI
WETISGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSSGLDFPKNISV
VAVCPKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFAT
TLEQEYRSDIFGERGILLGAVHGIVESLFRRYTENGMAEDLAYKNTVECITGTISRTIST
QGMLAVYNSLSEEGKKDFETAYSASFYPCMEILYECYEDVQSGSEIRSVVLAGRRFYEKE
GLPAFPMGNIDQTRMWKVGERVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSY
SEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDS
GAAINRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggcggctgcgacttcatccatcgctccttccctctcatgcccatctccttgttcttca
tccaaaacccttaggtcttctaaagctagagcctccttggctctgcccaatattggtttc
ctctcttcttcttccaagtctctgaggtctttaactgctaccgtcgctgggaatggtgtc
ggttcctccctcgccgctcgtatggtttcttcttctgcggtcaaagcccctatgtctttg
gatttcgagacatctgtcttcaaaaaggagaaagtctctcttgctggctacgaagagtac
attgtgagaggaggaagggatttgttcaaacatcttccagatgctttcaagggtgttaag
cagattggtgtgattggttggggatctcagggacctgcccaagctcagaatttgagagat
tcacttgtggaggctaagtctgacattgttgttaagattgggctcagaaaagggtctcgc
tcatttgaggaggcacgtgccgctggcttcactgaagaaagtggtactttgggtgatata
tgggaaactatctctggcagcgatcttgtgttgctgttgatctctgacgctgctcaggct
gataactatgagaaaatcttctctcacatgaagccaaacagcattctcggtttatcacac
gggtttctactagggcatttacagtcctcgggactcgatttcccaaagaacatcagtgtg
gtcgctgtgtgccctaagggaatgggtccttctgtgaggaggctatacgtccaaggaaaa
gaaatcaacggtgctggaatcaacgctagttttgcagtccaccaggatgtcgacggtaga
gccgccgatgttgcactgggatggtcagttgcacttggttctccttttacttttgctact
actcttgaacaagagtacaggagtgacatctttggagaaagaggcattttgctcggtgct
gtccatggaattgtggagtctctgtttagaaggtacaccgaaaatgggatggctgaagac
ttggcttacaagaacacagtagaatgcatcacaggaacaatttcaaggactatctctacc
cagggaatgttggccgtgtacaactccttgtctgaagaaggtaaaaaagattttgagact
gcatacagcgcatccttctatccttgtatggaaattctctatgaatgttacgaggatgta
caaagtggcagcgaaatccgaagtgtagtcttagccggtcgtcgcttctatgaaaaagaa
ggcttgccagcattcccaatgggaaacattgaccagacaagaatgtggaaggttggtgaa
cgtgtcaggaagtccagacctgctggtgacttgggtccattgtatcccttcaccgctgga
gtttatgtagcacttatgatggctcagattgagatcttgaggaagaaaggtcactcttac
tcagaaatcatcaacgagagtgtgattgaatcagtggactctctaaacccatttatgcac
gccaggggagtgtccttcatggttgacaactgctcgaccacagcaaggttgggttcgagg
aaatgggcaccacggttcgactacatcctgacccaacaagctcttgtggctgtggacagt
ggtgcagcgatcaacagagacctgatcagcaacttcttctctgacccagtccatggtgcc
attgaggtctgcgcacagctgaggccaaccgtcgatatctctgtgcctgctgatgcagac
tttgtccgacctgagttgcgtcaatctagcaactga

KEGG   Camelina sativa (false flax): 104781772
Entry
104781772         CDS       T05044                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104781772
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104781772
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     104781772
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 104781772
NCBI-ProteinID: XP_010504816
LinkDB
Position
4:22123713..22127038
AA seq 590 aa
MAAATSSIAPSLSCPSPCSSSKTLRSSKARALALPNIGFLSSSSKSLRSLTATVAGNGVG
SSLAARMVSSSAVKAPMSLDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGVKQ
IGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSRSFEEARAAGFTEESGTLGDIW
ETISGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSLGLDFPKNISVV
AVCPKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFATT
LEQEYRSDIFGERGILLGAVHGIVESLFRRYTENGMSEDLAYKNTVECITGTISRTISTQ
GMLAVYNSLSEEGKKDFETAYSASFYPCMEILYECYEDVQSGSEIRSVVLAGRRFYEKEG
LPAFPMGNIDQTRMWKVGERVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYS
EIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDSG
AAINRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggcggctgcgacttcatccatcgctccttccctctcatgcccatctccttgttcttca
tccaaaacccttaggtcttctaaagctagagccttggctctgcccaatatcggtttcctc
tcttcttcttccaagtctctgaggtctttaactgctaccgtcgctgggaatggtgtcggt
tcctccctcgccgctcgtatggtttcttcttctgcggtcaaagcccctatgtctttggat
ttcgagacatctgtcttcaaaaaggagaaagtctctcttgctggctacgaagagtacatt
gtgagaggaggaagggatttgttcaagcatcttccagatgctttcaagggggttaagcag
attggtgtgattggttggggatctcagggacctgcccaagctcagaatttgagagattca
cttgtggaggctaagtctgacattgttgttaagattgggctcagaaaagggtctcgctca
tttgaggaggcacgtgccgctggcttcactgaagaaagtggtactttgggtgatatatgg
gaaactatctctggcagtgatcttgtattgctgttgatctctgatgctgctcaggctgat
aactatgagaaaatattctctcacatgaagccaaacagcattctcggtttatcacacggg
tttctactagggcatttacagtccttgggactcgatttcccaaagaacatcagtgtggtc
gctgtgtgccctaagggaatgggtccttctgtgaggaggctatatgtccaaggaaaagaa
attaacggtgctggaattaacgctagttttgcagtccaccaggatgttgacggtagagct
gccgatgttgctctgggatggtcagtagcacttggttctccttttacttttgctactact
cttgaacaagagtacaggagtgacatctttggagaaagaggtattttgctcggtgctgtc
catggaattgtggagtctctgtttagaaggtacaccgaaaatgggatgagtgaagacttg
gcatacaagaacacagtagaatgcatcacaggaacaatttcaaggactatctctacccag
ggaatgttggccgtgtacaactccttgtctgaagaaggtaaaaaagatttcgagactgca
tacagcgcatccttctatccttgtatggagattctctatgaatgttatgaggatgtacaa
agtggtagtgaaatccgaagtgttgtcttagccggtcgtcgcttctatgaaaaagaagga
ttgccagcattcccaatgggaaacattgaccagacaagaatgtggaaggtgggtgaacgt
gtcaggaagtccagacctgctggtgacttgggtccattgtatcccttcaccgctggagtt
tatgtagcacttatgatggctcagattgagatcttgaggaagaaaggtcactcttactca
gaaatcatcaacgaaagtgtgattgaatcagtggactctctaaacccatttatgcacgcc
aggggagtgtccttcatggttgacaactgctcgaccacagcaagattgggttcgaggaaa
tgggcaccacggttcgactacatcctgacccaacaagctcttgtggctgtggacagtggt
gcagcgatcaacagagacctgatcagcaacttcttctctgacccagtccatggtgccatt
gaggtctgcgcacagctgaggcctaccgtcgatatctctgtgcctgctgatgcagacttt
gtccgacctgagttgcgtcaatctagcaactga

KEGG   Camelina sativa (false flax): 104792144
Entry
104792144         CDS       T05044                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104792144
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    104792144
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     104792144
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 104792144
NCBI-ProteinID: XP_010516509
LinkDB
Position
6:18425526..18428681
AA seq 590 aa
MAAATSSFAPSLSCPSPCSSSKTLRSSKARALALPNIGFLSSSSKSLRSLTATVAGNGVG
SSLAARMVSSSAVKAPMSLDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGVKQ
IGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSRSFEEARAAGFTEESGTLGDIW
ETISGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSLGLDFPKNISVV
AVCPKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFATT
LEQEYRSDIFGERGILLGAVHGIVESLFRRYTENGMSEDLAYKNTVECITGTISRTISTQ
GMLAVYNSLSEEGKKDFETAYSASFYPCMEILYECYEDVQSGSEIRSVVLAGRRFYEKEG
LPAFPMGNIDQTRMWKVGERVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYS
EIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDSG
AAINRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggcggctgcgacttcatccttcgctccttccctctcatgcccatctccttgttcttca
tccaaaacccttaggtcttctaaagctagagccttggctctgcccaatattggtttcctc
tcctcttcttccaagtctctgaggtctttaactgctaccgtcgctgggaatggtgtcggt
tcctccctcgccgctcgtatggtttcttcttctgcggtcaaagcccctatgtctttggat
ttcgagacatctgtcttcaaaaaggagaaagtctctcttgctggttacgaagagtacatt
gtgagaggaggaagggatttgttcaaacatcttccagatgctttcaagggtgttaagcag
attggtgtgattggttggggatctcagggacctgcccaagctcagaatctgagagattca
cttgtggaggctaagtctgacattgttgttaagattggtctcagaaaagggtctcgctca
tttgaggaggcacgtgccgctggcttcactgaagaaagtggtactttgggtgatatatgg
gaaactatctctggcagcgatcttgtattgctgttgatctctgatgctgctcaggctgat
aactatgagaaaatattctctcacatgaagccaaacagcattctaggtttatcacacggg
tttctacttgggcatttacagtccttaggactcgatttcccaaagaacatcagtgtggta
gctgtgtgccctaagggaatgggtccttctgtgaggaggctatacgtccaaggaaaagaa
atcaacggtgctggaatcaacgctagttttgcagtccaccaggatgttgacggtagagct
gccgatgttgcacttggatggtcagtagcacttggttctccttttacttttgctactact
cttgaacaagagtacaggagtgacatctttggagaaagaggtattttgctcggtgctgtc
catggaattgtggagtctctgtttagaaggtacaccgaaaatgggatgagtgaagacttg
gcttacaagaacacagtagaatgcatcacaggaacaatttcaaggactatctctacccag
ggaatgttggccgtgtacaactccttgtctgaagaaggtaaaaaagattttgagactgca
tacagcgcatccttctatccttgtatggagattctctatgaatgttacgaagatgtacaa
agtggcagcgaaatccgaagtgttgtcttagccggtcgtcgcttctatgaaaaagaaggc
ttgccagcattcccaatgggaaacattgaccagacaagaatgtggaaggttggtgaacgt
gtcaggaagtccagacctgctggtgacttgggtccattgtatcccttcactgctggagtt
tatgtagcacttatgatggctcagattgagatcttgaggaagaaaggtcactcttactca
gaaatcatcaacgagagtgtgattgaatcagtggactctctaaacccatttatgcacgcc
aggggagtgtccttcatggttgacaactgctcgaccacagcaagattgggttcgaggaaa
tgggcaccacggttcgactacatcctgacccaacaagctcttgtggctgtggacagtggt
gcagcgatcaacagagacctgatcagcaacttcttctctgacccagtccatggtgccatt
gaggtatgcgcacagctgaggcctaccgtcgatatctctgtgcctgctgatgcagacttt
gtccgacctgagttgcgtcaatctagcaactga

DBGET integrated database retrieval system