KEGG   Camelina sativa (false flax): 104713044
Entry
104713044         CDS       T05044                                 
Name
(RefSeq) cytosolic sulfotransferase 16
  KO
K11821  aromatic desulfoglucosinolate sulfotransferase [EC:2.8.2.24]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00380  Tryptophan metabolism
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Module
csat_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    104713044
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104713044
Enzymes [BR:csat01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.24  aromatic desulfoglucosinolate sulfotransferase
     104713044
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 104713044
NCBI-ProteinID: XP_010428378
LinkDB
Position
9:complement(29686856..29688107)
AA seq 337 aa
MESKTTQNGSQAELTEFEKTQKKYQALIATLPKSKGWRPDEILTQYGGHWWQECLLEGLF
HAKDHFEARPTDFLVCSYPKTGTTWLKALTYAIVNRSRFDDATNPLLKRNPHEFVPYVEI
DFAFYPTVDVLQDRKNPLFSTHIPNGSLPDSIVNSGCKMVYIWRDPKDTFISMWTFLHKE
KSQEGQLASLDESFDMFCKGLSVYGPYLDHVLGYWKAYQENPDRILFLRYETMKANPLPF
VKRLAEFMGYGFTAEEEEKGVAEKVVSLCSFETLKNLEANKGDKEREDRPAVYANSAYFR
KGKVGDWANYLTPEMAARIDGLVEEKFKDTGLLQHDS
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggaatcaaagacgacccagaacggatcccaagctgaactcacagagttcgaaaaaaca
cagaagaagtaccaagctctcatcgctacacttccaaagagcaaaggctggagacccgat
gagatcttaacacaatatggtggacactggtggcaagaatgtctcctcgaaggtcttttt
cacgctaaagaccatttcgaagcacgacccactgatttcctcgtctgtagctacccaaaa
accggtacgacttggctcaaagccttaacttacgccatcgtgaaccgttctcgtttcgac
gacgctacaaacccgcttctcaaacgtaaccctcacgagttcgtgccttacgttgagatc
gacttcgcgttttacccaaccgttgatgttcttcaggacagaaagaacccgcttttctct
acccatatccctaacgggtcgttacccgattccattgtgaactcgggttgcaaaatggtt
tacatatggagagacccaaaagacactttcatctccatgtggactttcttacacaaggag
aagtcacaagaaggtcaattagcgagtcttgacgagagctttgatatgttttgtaaaggt
ttatctgtgtacggtccttacctggatcatgttttaggttactggaaagcttaccaagag
aacccggataggattttgttccttaggtatgagaccatgaaagctaatcctttgccgttt
gtgaagaggttggctgagttcatgggttatggcttcactgctgaagaagaggagaaaggt
gttgctgagaaagtggtgagtctttgcagctttgagacgttgaagaatcttgaagctaac
aaaggagataaagaaagagaggatcgtcctgctgtttatgcgaatagcgcgtattttagg
aaaggaaaggttggagattgggcgaactatcttactccggagatggctgctcgtatcgat
ggtttggttgaggagaagttcaaagatactggcttacttcaacatgatagctga

DBGET integrated database retrieval system