KEGG   Camelina sativa (false flax): 104719113
Entry
104719113         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase large subunit, chloroplastic
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104719113
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104719113
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104719113
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104719113
    4.2.1.35  (R)-2-methylmalate dehydratase
     104719113
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-GeneID: 104719113
NCBI-ProteinID: XP_010435262
LinkDB
Position
10:16255326..16259659
AA seq 509 aa
MASSVISSSPFVCKSSKKDLGFSSFTKSSQISIHRCQKKSISRKIVSVMAPQKDRSPGTT
GSVKTGMTMTEKILARAAEKSLVVPGDNIWVNVDVLMTHDVCGPGAFGIFKREFGEKAKV
WDPEKIVVIPDHYIFTADKRANRNVDIMREHCKEQNIKYFYDITDLGNFKANPDYKGVCH
VALAQEGHCRPGEVLLGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKILLKVPPTMRFI
LDGEMPSYLQAKDLILQIIGEISVAGATYKTMEFSGTCIESLSMEERMTLCNMVVEAGGK
NGVIPPDATTLNYVENRTSVPFEPVYSDGNASFVAEYRFDVSKLEPVVAKPHSPDNRALA
RECKDVKIDRVYIGSCTGGKTEDFMAAAKLFHAAGKKVKVPTFLVPATQKVWMDVYALPV
PGSGGKTCAQIFEEAGCDTPASPSCGACLGGPADTYARLNEPQVCVSTTNRNFPGRMGHK
EGQIYLASPYTAAASALTGRVTDPREFLQ
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggcgtcctctgtaatctcttcctctcctttcgtctgcaaatcctccaagaaggatttg
gggttttcgtcgtttacgaaatcgtcgcagatttcgattcatcgatgtcagaagaaatcg
atttctcggaagattgtctctgttatggctccccagaaggatcggtctcctggcaccaca
ggatcggtgaagactgggatgacgatgacggagaagattctagcgagggcggctgagaag
tcattagtggttcctggtgataacatttgggttaatgttgatgttcttatgactcatgat
gtttgtggacctggtgcttttggtattttcaagagagagtttggtgaaaaggctaaggtt
tgggacccagagaagattgttgttattccagaccactatatattcacagctgataagcgt
gcaaaccgtaatgttgacattatgcgggaacattgcaaggaacagaacatcaagtatttc
tatgatatcaccgaccttggaaattttaaggctaatcctgactacaaaggtgtttgccat
gtcgcacttgcacaagaaggtcattgcaggccaggagaggttttgttaggaacagactca
cacacttgtactgccggagcatttggtcaatttgctacagggattggaaacactgatgca
ggctttgtgttagggactggaaaaatcctccttaaggttccaccaacaatgaggtttatc
ttggatggggaaatgcccagttacttgcaagcaaaggatttgattttgcaaatcattggt
gaaatatctgttgctggtgcaacttacaagacgatggagttcagtggtacatgcatcgaa
agtttgagtatggaagaaagaatgacactatgcaacatggttgtggaagctgggggaaag
aatggtgtcatccctcctgatgcgacaacattaaattatgtggagaataggacatctgtc
ccctttgaaccagtatacagtgatggaaatgcaagctttgtcgcagaatatagatttgat
gtgtcgaagctggagcctgtggtagccaagcctcattctcctgacaaccgggctctagca
agagaatgcaaagatgtgaaaattgacagagtatacatcggttcttgtactggtgggaag
acagaggattttatggctgcagctaagcttttccacgcagcaggaaagaaggtcaaagtc
ccaactttccttgtcccagctactcagaaggtgtggatggatgtgtatgctctcccggta
cctggatcaggtggaaagacatgtgcacagatctttgaagaagctggctgtgacactcca
gccagccctagctgcggtgcttgccttggtggtccagcagacacttacgctcgcttgaat
gaacctcaagtgtgtgtctcaaccacgaacaggaacttccctggacggatgggacacaaa
gaaggacagatttacttagcttctccttacactgctgcagcctcggccttaaccggccgt
gtcactgacccaagggagttcttgcagtag

KEGG   Camelina sativa (false flax): 104723857
Entry
104723857         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase large subunit, chloroplastic
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104723857
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104723857
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104723857
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104723857
    4.2.1.35  (R)-2-methylmalate dehydratase
     104723857
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-GeneID: 104723857
NCBI-ProteinID: XP_010440579
LinkDB
Position
11:19499082..19503444
AA seq 512 aa
MASSVISSSPFVCKSSSSSKKDLGFSSFTKSSQISIHRCQKKSISRKIVSVMAPQKDRSP
GTTGSVKTGMTMTEKILARAAEKSLVVPGDNIWVNVDVLMTHDVCGPGAFGIFKREFGEK
AKVWDPEKIVVIPDHYIFTADKRANRNVDIMREHCKEQNIKYFYDITDLGNFKANPDYKG
VCHVALAQEGHCRPGEVLLGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKILLKVPPTM
RFILDGEMPSYLQSKDLILQIIGEISVAGATYKTMEFSGTCIENLSMEERMTLCNMVVEA
GGKNGVIPPDATTLNYVENRTSVPFEPVYSDGNASFVADYRFDVSKLEPVVAKPHSPDNR
ALARECKDVKIDRVYIGSCTGGKTEDFMAAAKLFHAAGKKVKVPTFLVPATQKVWMDVYA
LPVPGSGGKTCAQIFEEAGCDTPASPSCGACLGGPADTYARLNEPQVCVSTTNRNFPGRM
GHKEGQIYLASPYTAAASALTGHVTDPREFLQ
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcttcctctgtaatctcttcctctcctttcgtctgcaaatcctcatcctcctccaag
aaggatttggggttttcgtcctttacgaaatcgtcgcagatttcgattcatcgatgtcag
aagaaatcgatttctcggaagattgtctctgttatggctccccagaaggatcggtctcct
ggcaccacaggatcggtgaagactgggatgacgatgacggagaagattctagcgagggcg
gctgagaagtcattagtggttcctggtgataacatttgggttaatgttgatgttcttatg
actcatgatgtttgtggacctggtgcttttggtatcttcaagagagagtttggtgaaaag
gctaaggtttgggacccagagaagattgttgttattccagaccactatatattcacagct
gataagcgtgcaaaccgtaatgttgacattatgcgggaacattgcaaggaacagaacatc
aagtatttctatgatatcaccgaccttggaaatttcaaggctaatcctgactacaaaggt
gtttgccatgtcgcacttgcacaagaaggtcattgcaggccaggagaggttttgttagga
acagactcccacacttgtactgccggagcatttggtcaatttgctacagggattggaaac
actgatgcaggctttgtgttagggactggaaaaatcctccttaaggttccaccaacaatg
aggtttatcttggatggggaaatgcccagttacttgcaatcaaaggatttgattttgcaa
atcattggtgaaatatctgttgctggtgcaacttacaagacgatggagttcagtggaaca
tgtatcgaaaatctgagtatggaagaaagaatgacactatgcaacatggttgtggaagct
gggggaaagaatggtgtcatcccacctgatgcgacgacattaaattatgtggagaatagg
acgtctgtaccctttgaaccagtatacagtgatggaaatgcaagctttgtcgcagattat
agatttgatgtgtcgaagctggagcctgtggtagccaagcctcattctcctgacaaccgg
gctctagcaagagaatgcaaagatgtgaaaattgacagagtatacatcggttcttgtact
ggtgggaagacagaggattttatggctgcagctaagcttttccacgcagcaggaaagaag
gtcaaagtcccaactttccttgtcccagctactcagaaggtgtggatggatgtgtatgcc
ctcccggtgcctggatcaggtggaaagacatgtgcgcagatctttgaagaagctggctgt
gacactccagccagccctagctgcggtgcttgccttggtggtccagcagacacttacgct
cgcttgaatgaaccacaagtgtgtgtctcaaccacgaacagaaacttccctggacggatg
ggacacaaagaaggacagatttacttagcttctccttacacagctgcggcctcggcctta
actggccatgtcactgacccaagggagttcttgcagtag

KEGG   Camelina sativa (false flax): 104732372
Entry
104732372         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase large subunit, chloroplastic
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104732372
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104732372
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104732372
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104732372
    4.2.1.35  (R)-2-methylmalate dehydratase
     104732372
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-GeneID: 104732372
NCBI-ProteinID: XP_010450205
LinkDB
Position
12:21028832..21033301
AA seq 513 aa
MASSVISSSPFVCKSSSSSSKKDLGFSSFTKSSQISIHRCQKKSISRKIVSVMAPQKDRS
PGTTGSVKTGMTMTEKILARAAEKSLVVPGDNIWVNVDVLMTHDVCGPGAFGIFKREFGE
KAKVWDPEKIVVIPDHYIFTADKRANRNVDIMREHCKEQNIKYFYDITDLGNFKANPDYK
GVCHVALAQEGHCRPGEVLLGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKILLKVPPT
MRFILDGEMPSYLQAKDLILQIIGEISVAGATYKTMEFSGTCIESLSMEERMTLCNMVVE
AGGKNGVIPPDATTLNYVENRTSVPFEPVYSDGNASFVADYRFDVSKLEPVVAKPHSPDN
RALARECKDVKIDRVYIGSCTGGKTEDFMAAAKLFHAAGKKVKVPTFLVPATQKVWMDVY
ALPVPGSGGKTCAQIFEEAGCDTPASPSCGACLGGPADTYARLNEPQVCVSTTNRNFPGR
MGHKEGQIYLASPYTAAASALTGHVTDPREFLQ
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcttcctctgtaatctcttcctctcctttcgtctgcaaatcctcatcctcctcctcc
aagaaggatttggggttttcgtcgtttacgaaatcgtcgcagatttcgattcatcgatgt
cagaagaaatcgatttctcggaagattgtctctgttatggctccccagaaggatcggtct
cctggcaccacaggatcggtgaagactgggatgacgatgacggagaagattctagcgagg
gcggctgagaagtcattagtggttcctggtgataacatttgggttaatgttgatgttctt
atgactcatgatgtttgtggacctggtgcttttggtatcttcaagagagagtttggtgaa
aaggctaaggtttgggacccagagaagattgttgttattccagaccactatatattcact
gctgataagcgtgcaaaccgtaatgttgacattatgcgggaacattgcaaggaacagaac
atcaagtatttctatgatatcactgaccttggaaattttaaggctaatcctgactacaaa
ggtgtttgccatgtcgcacttgcacaagaaggtcattgcaggccaggagaggttttgtta
ggaacagactcacacacttgtactgccggagcatttggtcaatttgctacagggattgga
aacactgatgcaggctttgtgttagggactggaaaaatcctccttaaggttccaccaaca
atgaggtttatcttggatggggaaatgcccagttacttgcaagcaaaggatttgattttg
caaatcattggtgaaatatctgttgctggtgcaacttacaagacgatggagttcagtggt
acatgtatcgaaagtctgagtatggaagaaagaatgacactatgcaacatggttgtggaa
gctgggggaaagaatggtgtcatccctcctgatgcgaccacattaaattatgtggagaat
aggacatctgtaccctttgaaccagtatacagtgatggaaatgcaagctttgtcgcagat
tatagatttgatgtgtcgaagctggagcctgtggtagccaagcctcattctcctgacaac
cgggctctagcaagagaatgcaaagatgtgaaaattgacagagtatacatcggttcttgt
actggtgggaagactgaggattttatggctgcagctaagcttttccacgcagcaggaaag
aaggtcaaagtcccaactttccttgtcccagctactcagaaggtgtggatggatgtgtat
gccctcccggtgcctggatcaggtggaaagacatgtgcgcagatctttgaagaagctggc
tgtgacactccagccagccctagctgcggtgcttgccttggtggtccagcagacacttac
gctcgcttgaatgaacctcaagtgtgtgtctcaaccacgaacaggaacttccctggacgg
atgggacacaaagaaggacagatttacttagcttctccttacacagctgcagcctcggcc
ttaactggccatgtcactgacccaagggagttcttgcagtag

KEGG   Camelina sativa (false flax): 104781804
Entry
104781804         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 3-like
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104781804
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104781804
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104781804
    4.2.1.35  (R)-2-methylmalate dehydratase
     104781804
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-GeneID: 104781804
NCBI-ProteinID: XP_010504861
LinkDB
Position
4:complement(22291047..22292614)
AA seq 257 aa
MAAASIQIKNPTFAKTLASSKNPSFLPFRSSSLSVNYSSTATNFKSIVSRVTPSTIVPRA
AASSSAETQVRKTFHGLCYVVGDNIDTDQIIPAEYLTFSTSNPADCEKLGSYALIGLPDS
YNERFVEQVEIKSKHSIIIGGENFGCGSSREHAPVCLGAAGAKAVVAQSYARIFFRNSVA
TGEVYPLESESRVCEECKTGDVASVELREGNCVLINHTTGKEYKLKAIGDAGPVIDAGGI
FDYARTAGMIPSPVVVA
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcggcggcttctatccagatcaaaaaccctacatttgccaagactttagcttcatcc
aaaaacccttcttttcttcctttccgatcatcttctctcagtgtcaattactcctcaacg
gccaccaatttcaaatccatagtctcaagagtcactccttcaacaatcgtcccacgcgcc
gccgcgtcttcttccgccgagactcaagttaggaagaccttccacggactgtgctacgtt
gttggtgataacatcgacaccgatcagatcattcccgccgagtatctcaccttttccacc
tcgaatccagccgattgcgagaagctcggctcttacgcgctgatcgggcttccagattcc
tacaatgagcgattcgtggagcaagtcgagataaaatccaagcactcaatcatcatcgga
ggtgaaaacttcggttgtggatcgtctcgtgagcacgcccctgtatgtctaggcgcagcg
ggagctaaggctgtggtggctcaatcttacgctagaatcttcttcaggaactctgtagct
accggagaggtttacccgttggagtccgagtctagggtttgtgaggagtgtaaaactgga
gatgttgcgagtgttgagctgagggaaggtaattgtgtgctgatcaatcatacgaccggg
aaagagtataagctcaaggccattggtgatgctggacctgtcattgacgccggtggtatt
ttcgattatgccaggacagctggcatgattccatctccagttgttgtagcctga

KEGG   Camelina sativa (false flax): 104781808
Entry
104781808         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 2-like
  KO
K21359  3-isopropylmalate/methylthioalkylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.170]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104781808
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104781808
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104781808
    4.2.1.170  2-(omega-methylthio)alkylmalate dehydratase
     104781808
SSDB
Motif
Pfam: Aconitase_C Aconitase_2_N
Other DBs
NCBI-GeneID: 104781808
NCBI-ProteinID: XP_010504874
LinkDB
Position
4:complement(22270262..22271450)
AA seq 259 aa
MATSLHSLNSTLFKSLASSSNKSSSSLSPSPVFRLNSTSAAFNFKPLTSSSSSSAIITRA
VASSSESGESHTRETFHGLCFVLKDNIDTDQIIPAEYGTLIPSIPEDRQKLGSFALNGLP
KLYSERFVVPGEMKSKYSVIIGGDNFGCGSSREHAPVCLGAAGAKAVVAESYARIFFRNC
VATGEIFPLESEVRICDECKTGDVVTVEHKEDGSSLLINHTTRKEYNLKPLGDAGPVIDA
GGIFAYARKAGMIPASSSA
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcgacttctctgcattctctaaactctacactcttcaaatccttggcttcctcctcc
aacaaatcctcttcgtctctctcaccatctcctgtcttccgactcaattccacctccgcg
gctttcaatttcaaaccacttacttcctcctcctcctcctccgcgatcatcacacgcgcc
gtcgcatcttcctccgaatcaggcgagtcgcataccagagagacatttcacggcctctgc
ttcgtcttgaaagacaacatagacaccgatcagatcatccccgccgagtacggcactctc
atcccttcgattccagaagaccggcagaagctcggctcgttcgcgctcaacggcttacca
aagttatacagtgaacgtttcgtggttccaggggagatgaaatcgaagtactcagtcatc
atcggcggtgataacttcggctgcggatcttcccgcgaacacgctccggtctgcctcgga
gctgcgggagctaaagccgtggtggcggaatcgtacgctaggatcttcttcaggaactgt
gtagctacaggtgagatcttcccgttggaatcggaggttaggatttgcgacgagtgtaag
acaggggatgtggttaccgtcgagcacaaggaagacggtagtagtttgctgatcaatcat
acgacgaggaaagaatataatctgaaaccactcggtgatgcaggtccggtgatcgacgcc
ggtggaatcttcgcttatgctagaaaagccggcatgattcctgcgtcgtcctctgcttga

KEGG   Camelina sativa (false flax): 104782824
Entry
104782824         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 3
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104782824
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104782824
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104782824
    4.2.1.35  (R)-2-methylmalate dehydratase
     104782824
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-GeneID: 104782824
NCBI-ProteinID: XP_010506167
LinkDB
Position
4:27544358..27545914
AA seq 252 aa
MAASLQSVNPTLSRNLSSPNNSSSFVPFRSPFLRFNSTSVAPDFKPLVSFRNASSSFVTR
SAAEPQERKTFHGLCYVVGDNIDTDQIIPAEFLTLVPSNPDEYEKLGSHALVGLPAAYKE
RFVQPGEMKTKYSIIIGGENFGCGSSREHAPVCLGAAGAKAVVAQSYARIFFRNSVATGE
IYPLDSEVRVCDECKTGDVATIELREGDSILINHTTGKEYKLKAIGDAGPVIDAGGIFAY
ARKAGMIPSAAP
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcggcttctcttcaatctgtaaaccctacattgtcacgaaacctatcttcaccgaac
aactcttcctccttcgttcccttccgatctccattcctcagattcaattccacctccgtc
gctcccgatttcaaacccctcgtttcgtttcgaaacgcatcatcatccttcgtcactcgc
tcagccgccgagccgcaagagagaaagaccttccatggactctgctacgtcgtcggtgac
aacatcgacaccgaccaaatcattcccgctgagtttctcacactcgtcccttcgaatcca
gacgagtacgagaagctcggctcccacgctctagttggtctcccagctgcttacaaggag
agattcgttcagcctggtgagatgaagaccaagtactcgatcatcatcggcggtgagaac
ttcggatgcggttcgtctcgtgaacacgctccggtttgtctcggcgcggcgggagctaaa
gcggtggtggctcagtcttacgctaggatctttttcaggaactctgtggctacgggtgag
atttatccgcttgattcggaagttagggtttgtgatgagtgtaaaacaggggatgttgcg
acgattgagttgagggaaggtgatagtattttgattaatcatacgactgggaaagagtat
aagctcaaggctataggtgacgctggacctgtcattgatgctggaggtatatttgcttat
gctaggaaagctggtatgattccttctgctgctccctga

KEGG   Camelina sativa (false flax): 104782825
Entry
104782825         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 1
  KO
K21359  3-isopropylmalate/methylthioalkylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.170]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104782825
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104782825
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104782825
    4.2.1.170  2-(omega-methylthio)alkylmalate dehydratase
     104782825
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-GeneID: 104782825
NCBI-ProteinID: XP_010506168
LinkDB
Position
4:27546206..27547169
AA seq 258 aa
MASSSLATLPQVLPSLSIKRSSSLAPFQSSSFLKINGSTSFTPSSISLTSRGKSSMTIIP
RAAAAGSESNEAVANTTFHGLCYVLKDNIDTDQIIPAGAACTFPTNQQERDEIAGHALSG
LPDFHKTRYVEPGENRSKYSIIIGGENFGCGSSREHAPVCLGAAGAKAIVAQSYARIFFR
NSVATGEVFPLESEVRVCDECKTGDTVTIELTETGGLLTNHTTGKNYNLKSIGDAGPVID
AGGIFSYARMMGMIPSLT
NT seq 777 nt   +upstreamnt  +downstreamnt
atggcgtcttcttctcttgctacattgccccaagtcttaccttccttatcaatcaaacgt
tcttcttccttggctcctttccaatcttcttctttcctcaaaatcaacggttccacttcc
ttcaccccctcctctatctccctcacttcacgtggcaaatcctccatgaccatcatccca
cgtgctgccgctgcaggatccgagtctaacgaagccgtagccaacaccaccttccacggt
ctctgctatgtcttgaaagacaacatagacaccgaccagatcatcccagcaggagctgct
tgcaccttcccaactaaccaacaagaacgtgacgagatcgctggtcacgctctctccggt
ctcccagacttccacaaaacccggtacgttgagccaggagagaacagatcaaagtactcg
atcataatcggtggagaaaactttggttgcggatcgtcgcgtgaacacgctccagtctgt
ctcggagcagctggagctaaagccatagttgctcagtcttacgcaaggatctttttccgt
aactctgtggctacaggagaggtgttcccgttagagtcagaggttagagtatgtgacgag
tgtaagactggagacacggtgacgatcgagctgactgaaactggtggtttgttgactaat
cacacaaccgggaaaaactataatctaaagtcgatcggtgatgcaggaccggttattgac
gctggtggtattttctcttatgcgagaatgatgggaatgattccatcattaacttaa

KEGG   Camelina sativa (false flax): 104785046
Entry
104785046         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 1-like
  KO
K21359  3-isopropylmalate/methylthioalkylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.170]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104785046
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104785046
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104785046
    4.2.1.170  2-(omega-methylthio)alkylmalate dehydratase
     104785046
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-GeneID: 104785046
NCBI-ProteinID: XP_010508471
LinkDB
Position
5:complement(2475662..2476667)
AA seq 260 aa
MASSSLATLSQVLPSSSTKHSSSLSPFQSSSFLKINGSTSFIPSSISLTSRGTSSTTIIP
RAAAAAGSDDSNEAVANTTFHGLCYVLKDNIDTDQIIPAGAACTFPTNQQERDEIAGHAL
SGLPDFHKTRYVEPGENRSKYSIIIGGVNFGCGSSREHAPVCLGAAGAKAIVAQSYARIF
FRNSVATGEVFPLESEVRVCDECKTGDTVTIELTETGGLLTNHTTGKNYNLKSIGDAGPV
IDAGGIFSYARMMGMIPSLA
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcgtcttcttctcttgctacattgtcccaagtcttaccttcctcatcaaccaaacat
tcttcttccttgtctcctttccaatcttcttctttcctcaaaatcaacggttccacttcc
ttcatcccctcctctatctccctcacttcacgtggcacatcctccacgaccatcatccca
cgtgctgctgccgctgcaggatctgacgactctaacgaagccgtagccaacacgaccttc
cacggtctctgctatgtcttgaaagacaacatagacaccgaccagatcataccagcagga
gccgcttgcactttcccaacgaaccaacaagaacgtgacgagatcgctggtcacgctctc
tctggtctcccagacttccacaaaacccggtacgttgagccaggagagaacagatcaaag
tactcgatcataatcggtggagtaaactttggttgcggatcgtcacgtgaacatgctcca
gtctgtctcggagcagctggagctaaagccatagttgctcagtcttacgcaaggatcttt
ttccgtaactcagtggctacaggagaggtgttcccgctagagtcagaggttagagtttgt
gacgagtgtaagactggtgacacggtgacgatcgagttgactgaaactggtggtttgttg
actaatcacacaaccgggaaaaactataatctaaagtcgatcggtgatgcaggaccggtt
attgacgctggtggtattttctcttatgcgagaatgatgggaatgattccatcattagct
taa

KEGG   Camelina sativa (false flax): 104785047
Entry
104785047         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 3-like
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00660  C5-Branched dibasic acid metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104785047
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104785047
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104785047
    4.2.1.35  (R)-2-methylmalate dehydratase
     104785047
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-GeneID: 104785047
NCBI-ProteinID: XP_010508472
LinkDB
Position
5:complement(2476998..2478546)
AA seq 254 aa
MAASLQSVNPTLSRNLSSPNNSSSFAPFRSPFLRFNSTTVASDFKPLVSFRNASSSSPFV
TRSAAEPQERKTFHGLCYVVGDNIDTDQIIPAEFLTLVPSNPDEYEKLGSHALVGLPAAY
KERFVQPGEMKTKYSIIIGGENFGCGSSREHAPVCLGAAGAKAVVAQSYARIFFRNSVAT
GEIYPLDSEVRVCDECKTGDVATIELREGDSILINHTTGKEYKLKAIGDAGPVIDAGGIF
AYARKAGMIPSAAP
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcggcttctcttcaatctgtaaaccctacattgtcccgaaacctatcttctccaaac
aactcttcctcattcgctcccttccgatctccattcctcagattcaactccaccaccgtc
gcttccgatttcaaacccctcgtttcgtttcgaaacgcatcatcatcatcacccttcgtc
actcgctcagccgccgagccgcaagagagaaagaccttccatggactctgttacgtcgtc
ggtgacaacatcgacacagaccaaatcattcccgctgagtttcttacactcgtcccttcg
aatccagacgagtacgagaaactcggttctcacgctctagttggtctcccagctgcttac
aaagaaagattcgttcagcctggtgagatgaagacaaagtactcgatcatcatcggcggt
gaaaacttcggatgcggttcgtctcgtgaacatgctccggtttgtcttggcgcggcggga
gctaaagcggttgtggctcagtcttacgctaggatctttttcaggaactctgttgctact
ggtgagatttatccgcttgattctgaagttagggtttgtgatgagtgtaaaacaggggat
gttgcgacgattgagttgagggaaggtgatagtattttgattaatcatacgactgggaaa
gagtataagttgaaggctattggtgatgctggtcctgttattgatgctggaggtatcttt
gcttatgctaggaaagctggtatgattccttctgctgctccctga

KEGG   Camelina sativa (false flax): 104788127
Entry
104788127         CDS       T05044                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 2
  KO
K21359  3-isopropylmalate/methylthioalkylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.170]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104788127
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104788127
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     104788127
    4.2.1.170  2-(omega-methylthio)alkylmalate dehydratase
     104788127
SSDB
Motif
Pfam: Aconitase_C Aconitase_2_N
Other DBs
NCBI-GeneID: 104788127
NCBI-ProteinID: XP_010512123
LinkDB
Position
5:complement(31938042..31939132)
AA seq 257 aa
MATSLHSLNSTLFKSLASSSNKSSSSLSPSPVFRLNPTSTAFIFKPLTSSSSAIIIRASA
SSSKSGESHTRETFHGLCFVLKDNIDTDQIIPAEYGTLIPSIPEDREKLGSFALNGLPKF
YGERFVVPGEMKSKYSVIIGGDNFGCGSSREHAPVCLGAAGAKAVVAESYARIFFRNCVA
TGEIFPLESEVRICDECKTGDVVTVEHKEDGSSLLINHTTRKEYKLKPLGDAGPVIDAGG
IFAYARKAGMIPSASSA
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcgacttctctgcattctctaaactctacactcttcaaatccttggcttcctcctca
aacaaatcctcctcatctctctcgccatctcctgtcttccgactcaatcccacctccacg
gctttcattttcaaaccactgacttcctcctcctccgcgatcatcatacgcgcctccgca
tcttcctccaaatcaggcgagtcgcataccagagagacatttcacggcctctgcttcgtc
ttgaaagacaacatagacaccgatcagatcatccccgcggagtacggcactctcatccct
tcgattccagaagaccgggagaagctcggctcgttcgcgctcaacggcttaccaaagttc
tacggtgaacgtttcgtggttccaggggagatgaaatcgaagtactcagtcatcatcggc
ggtgataacttcggctgcggatcttcccgcgaacacgctccggtctgcctcggagctgcg
ggagctaaagccgtggtggcggaatcgtacgctaggatcttcttcaggaactgtgtagct
acaggtgagatcttcccgttggaatcggaggttaggatttgcgacgagtgtaagacaggg
gatgtggttaccgtcgagcacaaggaagacggtagtagtttgctgatcaatcatacgacg
aggaaagaatataaactgaaaccactcggtgacgctggtccggtgatcgacgccggtgga
atcttcgcttatgctagaaaagccggcatgattccttctgcgtcctctgcttga

DBGET integrated database retrieval system