KEGG   Camelina sativa (false flax): 104730102
Entry
104730102         CDS       T05044                                 
Name
(RefSeq) cytochrome P450 83B1
  KO
K11818  aromatic aldoxime N-monooxygenase [EC:1.14.14.45]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00380  Tryptophan metabolism
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Module
csat_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    104730102
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104730102
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:csat00199]
    104730102
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.45  aromatic aldoxime N-monooxygenase
     104730102
Cytochrome P450 [BR:csat00199]
 Cytochrome P450, plant type
  CYP83 family
   104730102
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 104730102
NCBI-ProteinID: XP_010447503
LinkDB
Position
12:complement(4455068..4457090)
AA seq 499 aa
MDLFLIIAGLVAGAAFFFLQSTTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKL
YGPIFTMKIGGRRLAVISSAELAKDLLKTQDINFTARPLLKGQQTMSYQGRELGFGQYTT
YYREMRKMCMVNLFSPNRVASFRPVREEECKRMMDKIYKAADHSGTVDLSELLLSFTNCV
VCRQAFGKRYNEYGTEMKRFINILYETQALLGTLFFSDLFPYFGFLDNLTGLSARLKKAF
KELDTYLQELLDETLDPNRPNPETESFIDLLMQIYKDQPFSTKFTHENVKAMILDIVVPG
TDTAAAVVVWAMTYLIKYPKAMKKAQEEVRSVIGDKGYVSEEDIPNLPYLKAVIKESLRL
EPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDKAAWGDNPNEFIPERFMNEHK
GVDFKGQDFELLPFGSGRRMCPAMHLGVAMVEIPFANLLYKFDWSLSQGVKPEDIKMDVM
TGLAMHKKEHLVLAPTKHI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggatctcttcttgattatagccggtttggtagcgggtgcagccttctttttcctccag
agcaccaccaagaagtctctccggctacctccggggccaaaaggtcttcctattatagga
aaccttcaccagatggagaagttcaacccacaacatttccttttccgtctctccaagcta
tacggccccattttcactatgaaaatcggaggtcgtagactagccgtcatctcctcggcc
gaactagccaaggacctactcaagactcaagacatcaacttcaccgctcgtcctctcttg
aaaggccaacaaaccatgtcgtaccaaggacgtgagctcggtttcggacagtacaccacg
tactaccgtgagatgaggaagatgtgtatggtgaacctcttcagcccaaaccgtgtcgca
agtttcagacccgttagagaagaagagtgtaaacggatgatggacaagatatacaaagcc
gccgaccattcaggcaccgttgatctaagtgagcttctcttgtctttcacaaactgtgtt
gtatgcagacaagcttttgggaagcgttacaatgagtacggcaccgagatgaagagattc
ataaatatcttgtacgagacgcaagcacttttgggcactctttttttctccgaccttttc
ccttattttggatttcttgacaacctcactggtctcagtgctcgtctcaagaaagctttc
aaggagcttgacacttaccttcaagaactcctcgacgagactcttgaccctaaccgccct
aatcccgagacagagagtttcatcgatcttctgatgcagatctacaaagaccaacccttc
tccaccaaattcactcatgaaaatgtcaaggccatgatattggatattgtagtgccggga
actgacacggcggctgcagtggtagtatgggccatgacttaccttataaagtaccctaaa
gcgatgaagaaagctcaagaggaagtgaggagtgtgataggcgacaaaggatatgtctcg
gaagaagacatacctaatctcccttacctaaaagcagtcatcaaggagtctcttcggctg
gaaccagtcatccccattcttctacacagagaaactatcgcagacgcaaagatcggtggc
tatgatattccggcaaagaccatcatccaggtgaacgcgtgggcagtttctcgtgacaaa
gctgcgtggggagataaccctaatgagttcattccagagaggttcatgaacgagcacaaa
ggagtggacttcaagggccaagattttgagctcctacctttcggttcgggaaggagaatg
tgtccggccatgcatcttggggtagcaatggtagagatacctttcgctaaccttctctac
aaattcgactggagtctatctcaaggtgttaaaccggaggatataaagatggacgtcatg
accggacttgccatgcacaagaaagaacacctcgttcttgcaccaacgaaacatatctga

DBGET integrated database retrieval system