KEGG   Camelina sativa (false flax): 104732331
Entry
104732331         CDS       T05044                                 
Name
(RefSeq) cytochrome P450 83A1
  KO
K12156  (methylthio)alkanaldoxime N-monooxygenase [EC:1.14.14.43]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00966  Glucosinolate biosynthesis
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104732331
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:csat00199]
    104732331
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.43  (methylsulfanyl)alkanaldoxime N-monooxygenase
     104732331
Cytochrome P450 [BR:csat00199]
 Cytochrome P450, plant type
  CYP83 family
   104732331
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 104732331
NCBI-ProteinID: XP_010450163
LinkDB
Position
12:20407110..20408945
AA seq 502 aa
MEDITIGLVALAAVLLFFLYQKPKTKRYKLPPGPSPLPVIGNLHQLEKLNPQRFFARWAK
KYGPILSYKIGSRTMMVISSAELAKELLKTQDVNFANRPQHHGHEFISYGRRDMALNHYT
PYYREMRKMGMNHVFSPARVATFKHVREEEARRMIYKIDKAAEKSEAVDISELMLTFTNS
VVCRQAFGKKYNEEGEEMKRFISILYGTQSVLGKIFFADFFPYCGFLDNLSGLTAYLKEC
FDRADLYLQEVVNETLDPKRAKPETESMIDLLMGIYEAQPLASEFTIDNVKAVIMDIIVA
GTDTAAAAVVWGMTYLMKYPQVLKKAQAEVREYMREKGSTFVNEDDVKNLPYFKALVKET
LRIEPVIPLLIPRACIQDTKIAGYDVPAGTTVNVNAWAVSRDEKEWGPNPDEFRPERFFE
KDVDFKGTDYEFIPFGSGRRMCPGMRLGAAMLEVPYANLLLNYNFRLPNGMKPDEINMDV
MTGLAMHKAQHLKLVPEKVNMY
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggaagatattacaataggcctggtggctcttgccgcggttcttctcttctttctttac
caaaaaccgaaaaccaaacggtacaagctgccaccaggcccatcgccgcttccggtgatc
ggaaacctccaccagcttgagaagcttaacccacaacgctttttcgctagatgggccaaa
aaatacgggccaatcttgtcatacaagattggaagcagaacaatgatggtgatatcgtcg
gctgaactagctaaagagcttctcaagacgcaagatgtcaacttcgccaaccgacctcag
caccatggccatgagttcatatcctacggccggcgtgacatggcattgaaccactacaca
ccgtattaccgagagatgaggaagatggggatgaaccatgtattctcacctgcacgtgtg
gccacctttaagcacgtccgggaggaagaggctaggaggatgatttataagatcgataag
gccgcggaaaaatccgaagcggtcgatataagcgagcttatgttgaccttcacgaactcg
gttgtgtgtagacaagcgttcgggaagaagtacaacgaagagggggaagagatgaagagg
ttcatcagtattctctatgggactcagagcgttttggggaagatattttttgcagatttt
tttccctattgcggctttcttgataatttgtcaggcctcacagcttatctgaaagaatgt
tttgatagagcagacctttatcttcaagaggttgtcaatgagacgcttgatcccaaaagg
gccaagcccgaaaccgagagcatgatcgatctcttgatggggatttacgaagcacaacct
ttggcttctgagttcactattgataatgtcaaagccgtgatcatggatatcatagtggcg
ggaacagataccgcagctgcggcggttgtgtgggggatgacgtatctaatgaagtaccct
caagtattgaagaaagctcaagcagaagtgagagaatatatgagagagaaaggttcaacg
ttcgttaacgaagatgatgtcaagaaccttccttacttcaaggccttagttaaagaaacc
ctaaggatcgaaccggtcatacctctccttatccctcgtgcatgcattcaagacaccaag
atcgcgggttacgacgtcccggctgggactaccgttaacgtcaacgcgtgggctgtgtca
cgtgacgagaaggagtggggaccgaaccctgacgagttcaggcccgagaggttttttgag
aaggatgttgacttcaaaggcacggactacgagttcataccgtttgggtcaggccggaga
atgtgccccggaatgcgtcttggtgcggcgatgcttgaggttccttacgcgaaccttctt
cttaattataactttagacttcctaatgggatgaaaccagacgagatcaacatggatgtc
atgactggtctcgctatgcacaaggcgcagcatctcaagcttgttcccgagaaagtgaac
atgtactaa

DBGET integrated database retrieval system