KEGG   Camelina sativa (false flax): 104745183
Entry
104745183         CDS       T05044                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00260  Glycine, serine and threonine metabolism
csat00290  Valine, leucine and isoleucine biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    104745183
   00290 Valine, leucine and isoleucine biosynthesis
    104745183
Enzymes [BR:csat01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     104745183
SSDB
Motif
Pfam: PALP Thr_dehydrat_C PAC4
Other DBs
NCBI-GeneID: 104745183
NCBI-ProteinID: XP_010464666
LinkDB
Position
15:complement(4061836..4064808)
AA seq 591 aa
MDSVRLPTAPSSLRSHIPLPSKPVIGVTHFSRSRIPVAVLSRDDTSMAPPPPMSPLPRLK
VSPNSLQYPAGYLGAVPERTNDPQDGNIAEAMEYLTNILSTKVYDVAIESPLQLAKKLSK
RLGVKMLLKREDLQPVFSFKLRGAYNMMVKLPADQLAKGVICSSAGNHAQGVALSARKLG
CSAVIYMPETTPEIKWKSVEELGATVVRKGDTYDDAQAHAKERALAEGLTFIPPFDHPDV
IAGQGTIGMEITRQAKGPLHAIFVPVGGGGLIAGIAAYVKRVAPEVKIIGVEPADANAMA
LSLHHGERVILDKVGGFADGVAVKEVGEETFRISRNLMDGVVLVTRDAICASIKDMFEEK
RNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGANMNFDKLRIVTELANVGRQQEAVL
ATLLPEKPGSFKQFCELVGPVNITEFKYRCSTEKEAVVLYSVGVHTADELKALQNRMECS
QLKTVNLTTSDLVKDHLRYLMGGRSSVEDEVLCRFTFPERPGALMNFLDSLSPRWNISLF
HYRGQGETGANVLVGIQVPEQEMEEFKDRANTLGYEYLLVSDDDYFQLLMH
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggattccgtccggcttccaacggctccatcctctctccgtagccacattcccctgcct
tcaaaaccagtgatcggagtcactcacttctctcgatctcgtatcccagtcgctgttttg
tcccgagacgacacatctatggctccaccgcctccaatgtctcctctgccacgtctcaag
gtctctccgaactcgttgcagtaccctgccggttacctcggtgctgtaccagaacgtacg
aacgatcctcaagacggaaacatcgctgaagctatggagtatttgacgaatatactgtct
actaaggtttacgacgtcgccattgagtcaccactccaacttgctaagaagctttctaag
agattaggtgttaaaatgcttcttaaaagagaagacttgcaacctgttttctcgtttaag
cttcgtggagcttacaatatgatggtgaaactaccagcagatcagttggcaaaaggagtt
atctgctcctcagctggaaaccatgctcaaggagttgcgttatctgctaggaaacttggc
tgctctgctgtgatttatatgcctgaaacaaccccagagatcaagtggaaatctgttgag
gagttgggagcaacggttgttcgtaagggtgatacgtatgatgatgcacaagcacatgct
aaggaacgagctttagcagagggtttaacgtttatacctccttttgatcaccctgatgtt
attgctggacaagggactattgggatggagatcactcgtcaagctaagggtccattgcat
gctatatttgtgccagttggtggtggtggtttaatagctggtattgctgcttatgtcaag
agggttgctcccgaggtgaagatcattggtgtagaaccagctgatgcaaatgcaatggcg
ttgtcgctgcatcacggtgagagggtgatattggacaaggttgggggttttgcagatggt
gttgcagttaaagaagttggtgaagagacttttcgtataagcagaaatctaatggatggt
gttgttcttgtcactcgtgatgctatttgtgcatcaataaaggatatgtttgaggagaaa
cggaacatattggaaccagcaggggctctcgcgctcgctggagctgaggcatactgtaaa
tattatggcctaaaggacgtgaatgtcgtagccataaccagtggtgcaaacatgaacttt
gacaagctaaggattgtgacagaactcgcaaatgtcggaaggcaacaggaggctgttctt
gctactctcctaccggaaaaacctggaagctttaagcaattctgtgaactggttggacca
gtgaacataaccgagttcaaatatagatgtagcacagaaaaggaggctgttgtattatac
agtgttggagttcacacagccgatgagctcaaagcactacagaatagaatggaatgctct
caacttaaaacagtcaatctcacaaccagtgacttagtgaaagatcacctgcgttacttg
atgggtggaagatcaagtgttgaagacgaggttctatgccggttcacctttcccgagaga
cctggtgctctaatgaacttcttggactctttgagtccacggtggaacatcagccttttc
cattaccgtggacagggtgagacgggcgcgaatgtgctggtggggatccaagtgcccgag
caagaaatggaggaatttaaagaccgagcgaacactcttggatatgagtacttgttggta
agtgatgacgactattttcagcttctgatgcactga

KEGG   Camelina sativa (false flax): 104758958
Entry
104758958         CDS       T05044                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00260  Glycine, serine and threonine metabolism
csat00290  Valine, leucine and isoleucine biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    104758958
   00290 Valine, leucine and isoleucine biosynthesis
    104758958
Enzymes [BR:csat01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     104758958
SSDB
Motif
Pfam: PALP Thr_dehydrat_C PAC4
Other DBs
NCBI-GeneID: 104758958
NCBI-ProteinID: XP_010480268
LinkDB
Position
1:complement(3878577..3881506)
AA seq 591 aa
MDSVRLPTAPSSLRSHIPLPSKPVIGVTHFSRSRIPVAVLSRDDTSMAPPPPMAPLPRLK
VSPNSLQYPAGYLGAVPERTNDPEDGSIAEAMEYLTNILSTKVYDVAIESPLQLAKKLSK
RLGVKMLLKREDLQPVFSFKLRGAYNMMVKLPADQLAKGVICSSAGNHAQGVALSARKLG
CSALIYMPETTPEIKWKSVEELGATVVRKGDTYDDAQAHAKERALAEGLTFIPPFDHPDV
IAGQGTIGMEITRQAKGPLHAIFVPVGGGGLIAGIAAYVKRVAPEVKIIGVEPADANAMA
LSLHHGERVILDKVGGFADGVAVKEVGEETFRISRNLMDGVVLVTRDAICASIKDMFEEK
RNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGANMNFDKLRMVTELANVGRQQEAVL
ATLMPEKPGSFKQFCELVGPVNITEFKYRCSTEKEAVVLYSVGVHTADELKALQNRMECS
QLKTVNLTTSDLVKDHLRYLMGGRSSVEDEVLCRFTFPERPGALMNFLDSLSPRWNISLF
HYRGQGETGANVLVGIQVPEQEMGEFKDRANALGYDYFLVSDDDYFQLLMH
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggattccgtccggcttccaacggctccatcctctctccgtagccacattcccctgcct
tcaaaacctgtgatcggagtcactcacttctctcgatctcgtatcccagtcgcagttttg
tctcgagacgacacatctatggctccaccgcctccgatggctcctctgccacgtctcaag
gtctctccgaactcgttgcaataccctgccggttacctcggtgctgtaccagaacgtacg
aacgatcccgaggacggaagcatcgcggaagctatggagtatttgacgaatatactgtct
actaaggtttacgacgtcgccattgagtcaccacttcaattggctaagaagctttctaag
aggttaggtgttaaaatgcttcttaaaagagaagacttgcaacctgttttctcgtttaag
cttcgtggagcttacaatatgatggtgaaactaccagcagatcagttggcaaaaggagtt
atctgctcctcagctggaaaccatgctcaaggagttgctttatctgctaggaaactcggc
tgcagtgctctgatttatatgcctgaaacaaccccagagatcaagtggaaatctgttgag
gagttgggtgcaacggttgttcgtaagggggatacgtatgatgatgcacaagcacatgct
aaggaacgagctttagcagagggtctaacgtttatacctccttttgatcacccggatgtt
attgctggacaagggactattgggatggagatcactcgtcaggctaagggtccattacat
gctatatttgtgccagttggtggtggtggtttaatagctggtattgctgcttatgtgaag
agggttgctcccgaggtgaagatcattggtgtagaaccagctgatgcaaatgcaatggcg
ttgtcgctgcatcacggtgagagagtgatattggacaaggttgggggttttgctgatggt
gttgcagttaaagaagttggtgaagagacttttcgtataagcagaaatctaatggatggt
gtagttcttgtcactcgtgatgctatttgtgcatcaataaaggatatgtttgaggagaaa
cggaacatattggaaccagcaggtgctctcgcgatcgctggagctgaggcatactgtaaa
tattatggcctaaaggacgtgaatgtcgtagccataaccagtggtgcaaacatgaacttt
gacaagctaaggatggtgacagaactcgccaatgtcggtaggcaacaggaggctgttctt
gctactctcatgccggaaaaacctggaagctttaagcaattctgtgaactggttggacca
gtgaacataaccgagttcaaatatagatgtagcacagaaaaggaggctgttgtattatac
agtgttggagttcacacagccgatgagctcaaagcactacagaatagaatggaatgctct
caacttaaaactgtcaatctcacaaccagtgacttagtgaaagatcacctgcgttacttg
atgggtggaagatcaagtgttgaagacgaggttctatgccggttcacctttcccgagaga
cctggtgctctaatgaacttcttggactctttgagtccacggtggaacatcagccttttc
cattaccgtggacagggtgagacgggcgcgaatgtgctggtggggatccaagtgcccgag
caagaaatgggggaatttaaagaccgagctaacgctcttggatatgactacttcttggta
agtgatgacgactactttcagcttctgatgcactga

KEGG   Camelina sativa (false flax): 104764702
Entry
104764702         CDS       T05044                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00260  Glycine, serine and threonine metabolism
csat00290  Valine, leucine and isoleucine biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
csat01230  Biosynthesis of amino acids
Module
csat_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    104764702
   00290 Valine, leucine and isoleucine biosynthesis
    104764702
Enzymes [BR:csat01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     104764702
SSDB
Motif
Pfam: PALP Thr_dehydrat_C PAC4
Other DBs
NCBI-GeneID: 104764702
NCBI-ProteinID: XP_010486587
LinkDB
Position
19:complement(4194892..4198713)
AA seq 591 aa
MDSVRLPTAPSSLRSHIPLPSKPVIGVTHFSRSRITVAVLSRDDTSMAPPPPMAPLPRLK
VSPNSLQYPAGYLGAVPERTNDSEDGSIAEAMEYLTNILSTKVYDVAIESPLQLAKKLSK
RLGVKMLLKREDLQPVFSFKLRGAYNMMVKLPADQLAKGVICSSAGNHAQGVALSARKLG
CSAVIYMPETTPEIKWKSVEELGATVVRKGDTYDDAQAHAKERALAEGLTFIPPFDHPDV
IAGQGTIGMEITRQAKGPLHAIFVPVGGGGLIAGIAAYVKRVAPEVKIIGVEPADANAMA
LSLHHGERVILDKVGGFADGVAVKEVGEETFRISRNLMDGVVLVTRDAICASIKDMFEEK
RNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGANMNFDKLRMVTELANVGRQQEAVL
ATLMPEKPGSFKQFCELVGPVNITEFKYRCSTEKEAVVLYSVGVHTADELKALQNRMECS
QLKTVNLTTSDLVKDHLRYLMGGRSSVEDEVLCRFTFPERPGALMNFLDSLSPRWNISLF
HYRGQGETGANVLVGIQVPEQEMEEFKDRANALGYDYFLVSDDDYFQLLMH
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggattccgtccggcttccaacggctccatcctctctccgtagccacattcccctgcct
tcaaaacctgtgatcggagtcactcacttctctcgatctcgtatcacagtcgcagttttg
tcccgagacgacacatctatggctccaccgcctccgatggctcctctgccacgtctcaag
gtctctccgaactcgttgcagtaccctgccggttacctcggtgctgtaccagaacgtacc
aacgattccgaggacggaagcatcgcggaagctatggagtatttgacgaatatactgtct
actaaggtttacgacgtcgccattgagtcaccactccaattggctaagaagctttctaag
agattaggtgttaaaatgcttcttaaaagagaagacttgcaacctgttttctcgtttaag
cttcgtggagcttacaatatgatggtgaaactaccagcagatcagttggcaaaaggagtt
atctgctcctcagctggaaaccatgctcaaggagttgctttatctgctaggaaactcggc
tgctctgctgtgatttatatgcctgaaacaaccccagagatcaagtggaaatctgttgag
gagttgggtgcaacggttgttcgtaagggtgatacgtatgatgatgcacaagcacatgct
aaggaacgagctttagcagagggtttaacgtttatacctccttttgatcaccctgatgtt
attgctggacaagggactattgggatggagatcactcgtcaggctaagggtccattgcat
gctatttttgtgccagttggtggtggtggtttaatagctggtattgctgcctatgtcaag
agggttgctcccgaggtgaagatcattggtgtagaaccagctgatgcaaatgcaatggcg
ttgtcgctgcatcacggtgagagggtgatattggacaaggttgggggttttgcagatggt
gtagcagttaaagaagttggtgaagaaacttttcgtataagcagaaatctaatggatggc
gttgttcttgtcactcgtgatgctatttgtgcatcaataaaggatatgtttgaggagaaa
cggaacatattggaaccagcaggtgctctcgcgatcgctggagctgaggcatactgtaaa
tattatggcctaaaggacgtgaatgtcgtagccataaccagtggtgcaaacatgaacttt
gacaagctaaggatggtgacagaactcgccaatgtcggtaggcaacaggaggctgttctt
gctactctcatgccggaaaaacctggaagctttaagcaattctgtgaactggttggacca
gtgaacataaccgagttcaaatatagatgtagcacagaaaaggaggctgttgtattatac
agtgttggagttcacacagccgatgagctcaaagcactacagaatagaatggaatgctct
caacttaaaactgtcaatctcacaaccagtgacttagtgaaagatcacctgcgttacttg
atgggtggaagatcaagtgttgaagacgaggttctatgccggttcacctttcccgagaga
cctggtgctctaatgaacttcttggactctttgagtccacggtggaacatcagccttttc
cattaccgtggacagggtgagacgggcgcgaatgtgctggtggggatccaagtgcccgag
caagaaatggaggaatttaaagaccgagcgaacgctctcggatatgactacttcttggta
agtgatgacgactactttcagcttctgatgcactga

DBGET integrated database retrieval system