Cryptotermes secundus (drywood termite): 111875773 Help Entry 111875773         CDS       T07421                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism csec  Cryptotermes secundus (drywood termite) Pathway csec04013   MAPK signaling pathway - fly csec04068   FoxO signaling pathway csec04137   Mitophagy - animal csec04140   Autophagy - animal csec04150   mTOR signaling pathway csec04213   Longevity regulating pathway - multiple species csec04214   Apoptosis - fly csec04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:csec00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     111875773    04068 FoxO signaling pathway     111875773    04150 mTOR signaling pathway     111875773  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111875773    04137 Mitophagy - animal     111875773   09143 Cell growth and death    04214 Apoptosis - fly     111875773  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     111875773   09149 Aging    04213 Longevity regulating pathway - multiple species     111875773  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csec04131]     111875773   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:csec04031]     111875773 Membrane trafficking [BR:csec04131]  Endocytosis   Macropinocytosis    Ras GTPases     111875773 GTP-binding proteins [BR:csec04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111875773 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase G-alpha Septin FeoB_N NB-ARC Ldh_1_N Motif Other DBs NCBI-GeneID:  111875773 NCBI-ProteinID:  XP_023728055 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MKMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDT AGQEEYSAMRDQYMRTGEGFLLVFAVNNAKSFEDISMYREQIKRVKDAEEVPMVLVGNKC DLPTRTVELTQAQEVAKQYMIPFVETSAKTRLGVDDAFYTLVREIRKDKEHRGRGGKKPG IGYRRKPCCLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgaaaatgacggaatataaactcgttgttgtgggagctggaggtgttggaaaaagtgcc ttgacaattcagcttatacagaatcattttgttgatgaatacgacccaacaatagaggac tcatatcggaagcaagttgtcattgatggagaaacctgcttgctggatatactggacaca gcaggacaagaagaatacagtgccatgagggaccagtacatgaggacaggagaaggtttc ctgctggtctttgctgtaaacaatgccaaatcatttgaagatatcagcatgtatcgcgaa cagattaagagggttaaagatgctgaagaagttcccatggttttggtgggaaataagtgt gacttgccaacacgaaccgtggaattgactcaggcacaggaagttgccaagcaatacatg attccttttgtagaaacctcagcgaaaacacgacttggcgtggatgatgccttctataca ttggttcgggagattaggaaagataaagagcatcgtgggagaggcggaaagaagcctgga ataggctacagacggaagccatgctgtcttttataa

DBGET integrated database retrieval system