Comamonas squillarum: N4T19_02065 Help Entry N4T19_02065       CDS       T10846                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism csqu  Comamonas squillarum Pathway csqu02024   Quorum sensing csqu03018   RNA degradation Brite KEGG Orthology (KO) [BR:csqu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     N4T19_02065 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     N4T19_02065 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csqu03019]     N4T19_02065 (hfq)    03036 Chromosome and associated proteins [BR:csqu03036]     N4T19_02065 (hfq) Messenger RNA biogenesis [BR:csqu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      N4T19_02065 (hfq) Chromosome and associated proteins [BR:csqu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     N4T19_02065 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UXC18942 UniProt:  A0ABY5ZY74 LinkDB All DBs Position 452306..452557 Genome browser AA seq 83 aa AA seqDB search MSNKGQLLQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAI STIVPGRAVNFSAPDSQDNEASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgagcaacaaaggccaacttctgcaagatcccttcctcaacgctctgcgccgcgagcat gtgccagtgtccatctatttggtcaacggcatcaagctccaaggccagatcgaatctttt gaccagtacgttgtgctgctgcgcaacaccgtcacccagatggtgtacaagcatgcgatc tcgaccattgtccccggtcgtgccgtgaacttctcggcacctgactcgcaagacaacgaa gcttcagcctaa

DBGET integrated database retrieval system