Colius striatus (speckled mousebird): 104557905 Help Entry 104557905         CDS       T08355                                  Name (RefSeq) hemoglobin subunit alpha-A   KO K13822   hemoglobin subunit alpha Organism csti  Colius striatus (speckled mousebird) Brite KEGG Orthology (KO) [BR:csti00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csti04147]     104557905 Exosome [BR:csti04147]  Exosomal proteins   Exosomal proteins of hepatic cells    104557905 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Globin Motif Other DBs NCBI-GeneID:  104557905 NCBI-ProteinID:  XP_010200593 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search AANHIDDIATALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSVLTPEVHASLDKF LCAVGTVLTAKYR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gctgccaaccacatcgatgacatcgccactgccctctccaagctcagcgacctccacgcc cagaagctccgcgtggaccccgtcaacttcaaactgctgggccaatgcttcctggtggtg gtggccatccaccacccctccgtcctgaccccggaggtccatgcttccctggacaagttc ctgtgcgccgtgggcaccgttctgactgccaagtaccgttaa

DBGET integrated database retrieval system