Carlito syrichta (Philippine tarsier): 103252436 Help Entry 103252436         CDS       T07836                                  Symbol EFNA3 Name (RefSeq) ephrin-A3   KO K05462   ephrin-A Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04010   MAPK signaling pathway csyr04014   Ras signaling pathway csyr04015   Rap1 signaling pathway csyr04151   PI3K-Akt signaling pathway csyr04360   Axon guidance csyr05206   MicroRNAs in cancer Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103252436 (EFNA3)    04014 Ras signaling pathway     103252436 (EFNA3)    04015 Rap1 signaling pathway     103252436 (EFNA3)    04151 PI3K-Akt signaling pathway     103252436 (EFNA3)  09150 Organismal Systems   09158 Development and regeneration    04360 Axon guidance     103252436 (EFNA3)  09160 Human Diseases   09161 Cancer: overview    05206 MicroRNAs in cancer     103252436 (EFNA3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103252436 (EFNA3)    00536 Glycosaminoglycan binding proteins [BR:csyr00536]     103252436 (EFNA3)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:csyr00537]     103252436 (EFNA3) Cytokines and neuropeptides [BR:csyr04052]  Cytokines   Growth factors (RTK binding)    103252436 (EFNA3) Glycosaminoglycan binding proteins [BR:csyr00536]  Heparan sulfate / Heparin   Axon guidance molecules    103252436 (EFNA3) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:csyr00537]  Others   103252436 (EFNA3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ephrin Motif Other DBs NCBI-GeneID:  103252436 NCBI-ProteinID:  XP_021564778 UniProt:  A0A3Q0DSH8 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search CSHSLRREGYTVQVNVNDYLDIYCPHYNTTPTHNLHWKCLRMKVFVCCASTSHSGEKPVP TLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTLLAS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt tgttcccacagcctgcggcgagagggctacaccgtgcaggtgaacgtgaacgattatctg gacatctactgcccgcactacaacaccacgcccacccacaacctgcactggaagtgtctg aggatgaaggtgttcgtctgctgcgcctccacatcgcactccggggagaagccggtcccc actctcccccagttcaccatgggccccaatgtgaagatcaacgtgctggaagactttgag ggagagaacccccaggtgcccaagcttgagaagagcatcagcgggaccagccccaaacgg gaacacctgcccctggccgtgggcatcgccttcttcctcatgacgctcttggcctcctag

DBGET integrated database retrieval system