KEGG   Comamonas testosteroni TK102: O987_08255
Entry
O987_08255        CDS       T03218                                 
Name
(GenBank) benzene 1,2-dioxygenase
  KO
K08689  biphenyl 2,3-dioxygenase subunit alpha [EC:1.14.12.18]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00621  Dioxin degradation
ctes01100  Metabolic pathways
ctes01120  Microbial metabolism in diverse environments
ctes01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    O987_08255
Enzymes [BR:ctes01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     O987_08255
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AIJ45797
UniProt: A0A076PQW2
LinkDB
Position
complement(1796807..1798183)
AA seq 458 aa
MGIHSEREVQAVPLTFKRRWTDEAIRALVDQDKGLLDPRIYADQDLYEIELERVFARSWL
LLGHEAHIPKTGDYLTTYMGEDPVIMVRQKDGSIKVFLNQCRHRGMRICRSDAGNAKAFT
CTYHGWAYDIAGNLVNVPYEKEAFCDQKEGDCGFDKADWGPLQARVETYKGLIFANWDAE
APDLKTYLSDAMPYMDVMLDRTEAGTTVVGGMQKWVIPCNWKFAAEQFCSDMYHAGTMSH
VSGVLASLPPNMELTDVQMPKNGAQFRAAWGGHGTGWYINDPDILMAVMGPKITQFWTEG
PAAEKAAKRLNQMPTQTMFGQHMTVFPTCSFLPGINTIRTWHPRGPNEVEVWAFVVVDAD
APEDIKEEFRRQNIRTFSAGGTFEQDDGENWVEIQRGLRGHKAKSAPLCAHMGINVPNKS
NPDFPGKTAYVYAEEAARGMYHHWARMMSEPSWDTLKP
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgggaatacattcggaacgcgaagtgcaagccgtgccgctgacgttcaagcgtcgctgg
acggacgaagccatccgcgcactggtcgatcaagacaagggcttgctcgacccgcgcatc
tacgcagaccaggatctctacgagattgagctcgagcgcgtctttgcgcgctcttggctg
ctgctcgggcatgaagcccacatccccaagaccggggactacctgaccacctacatgggc
gaagaccctgtgatcatggtgcggcaaaaggacggaagcatcaaagtcttcctgaaccag
tgccgccaccgtggcatgcgcatttgccgctccgacgcgggcaatgccaaggccttcacc
tgcacctaccacggctgggcgtatgacatcgccggcaacctggtcaacgtgccctacgaa
aaagaggctttctgcgatcaaaaagaaggcgactgcggcttcgacaaagccgactggggc
ccgctgcaagcgcgcgtggaaacctacaagggcctgatcttcgcgaactgggacgccgag
gcccctgacctcaagacctacctgagcgacgccatgccctacatggacgtgatgctcgac
cgcaccgaagccggcaccaccgtcgtcggcggcatgcaaaagtgggtcatcccctgcaac
tggaagtttgccgccgagcaattctgcagcgacatgtaccacgccggcacgatgtcgcac
gtgtcgggagtcttggccagcctgccgcccaatatggaattgacggatgttcaaatgccg
aagaacggggcgcaattccgcgcggcttggggtgggcatggcaccggctggtacatcaac
gatcccgacattctgatggccgtcatgggccccaagatcacccaattttggaccgaaggt
ccggctgcagaaaaagccgccaagcgcctgaaccagatgccgacgcaaaccatgttcggc
cagcacatgacagtgttcccgacctgttcattcctgccaggcatcaacaccatccgcacg
tggcacccgcgtggccccaatgaagtggaagtgtgggccttcgtggtcgtcgatgcagac
gcgcccgaggacatcaaggaagagtttcgccgccagaacatccgcactttcagtgctggc
ggtacctttgagcaggacgatggtgagaactgggtcgaaatccagcgtgggctccgtggc
cacaaggccaagagcgctcccctttgtgcgcatatgggcatcaacgtgcccaacaagagc
aacccggatttcccaggcaagacagcttacgtctacgccgaagaagcagctcgaggcatg
taccaccactgggcgcgcatgatgtccgagccaagctgggacacgctcaagccctga

DBGET integrated database retrieval system