Chlamydia trachomatis D-LC: CTDLC_0612 Help Entry CTDLC_0612        CDS       T01901                                  Symbol folA Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ctf  Chlamydia trachomatis D-LC Pathway ctf00670   One carbon pool by folate ctf00790   Folate biosynthesis ctf01100   Metabolic pathways ctf01240   Biosynthesis of cofactors ctf04981   Folate transport and metabolism Module ctf_M00840   Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF Brite KEGG Orthology (KO) [BR:ctf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CTDLC_0612 (folA)    00670 One carbon pool by folate     CTDLC_0612 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CTDLC_0612 (folA) Enzymes [BR:ctf01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CTDLC_0612 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  ADI52300 LinkDB All DBs Position complement(691821..692318) Genome browser AA seq 165 aa AA seqDB search MGWYVCMIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPD KYKHGRDIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFV THIKKEYWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT NT seq 498 nt NT seq  +upstreamnt  +downstreamnt ttgggctggtatgtttgtatgatccaagcaacaggtatcgttgctattgatcccagagga gtgatgggagctttaggcaagctcccttggagttatcccgaagatctacgtttttttgca gaaaccattcgaaatcatcccatcattatgggacgaaagacttgggagtctcttccagac aagtataagcatgggcgggatatcgttgtcttttctcgcaggatgcatccaccacaatgc ataggagtttcttcctttgcagagtatgggacactatctttgaatcatccgtttttaatt gggggagcggagctctttgaaagttttttccaacaaaaccttctgaaagcttgttttgtc acacatatcaaaaaggaatattggggcgatactttcttccctatcacgcgattatcagga tggaagaaggaatgtatttgtaatacagaggatttcagtatttattattatgaaaataac tccgatcaaaacacgtaa

DBGET integrated database retrieval system