KEGG   Candida tropicalis: CTRG_02441
Entry
CTRG_02441        CDS       T01115                                 
Name
(RefSeq) conserved hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
ctp  Candida tropicalis
Pathway
ctp04111  Cell cycle - yeast
ctp04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CTRG_02441
   04113 Meiosis - yeast
    CTRG_02441
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ctp03400]
    CTRG_02441
DNA repair and recombination proteins [BR:ctp03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    CTRG_02441
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 8297559
NCBI-ProteinID: XP_002548144
UniProt: C5MAC9
LinkDB
Position
Unknown
AA seq 473 aa
MAFEAEIGVNKHKLMWSKSIASLASIAETITFSITKDSLSLSTNNLTKTTHAEIIFKKSF
FSTYSVDFKNILPEGFNEGRVDSESTYSFLVNSRHLTTVFKGLDSNSMKYACIRINWSQE
APINSRYKLFIEMKTKKLIVKKFQTSYVPATKHNIRVASVYKDALYAQKEDNFDEPNRIN
HIMIDQVIPKQFLEMVPASAEDFKIEIKSDRVSFSGYTKQIIKDRDYLKQPMAVTVTISL
EELTDTNLLSLNPNDKPISKMINFGMRDFKNFLNLVSFFNSSTSYSEQLDEDFITVANND
YFHMFFRNPGDPILFDLQNNQHMEVQYIQITSEDKTEMNAKEINADTLKKDLLIEGSVPQ
KVDNDSVDQSRTPSLIKPIGSTTFGKPTIARIPTTSESGISQNDPSQSYAVGITYEQESE
ERQIPAGVTKTGDETDYSDETEEDEDEGPPRKRMLISDELGPTQLTNKAKSIF
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcatttgaagcagaaataggtgttaataagcacaagcttatgtggtctaaatcgatt
gcatcactagcgagtatagcagaaacaatcacttttagtattacaaaggattctttatca
ttatcaaccaacaatcttaccaagaccacacatgctgagattatcttcaagaaatcattt
ttcagcacatattctgttgattttaaaaatatacttccagaagggtttaatgaaggaagg
gtggattcagaactgacatattcatttcttgtgaattcacgtcatttaactaccgtgttt
aaaggtttggattcaaacagcatgaagtacgcgtgtattagaattaactggtcacaagaa
gcaccaataaatctgagatacaaattattcattgaaatgaagaccaagaaacttattgtc
aaaaaattccaaacgagttatgttccagcgacaaaacacaatattagagttgcaagtgtt
tacaaggatgcgttgtatgcacaaaaggaggacaattttgatgaaccaaatagaatcaac
catattatgatcgatcaagttatacctaaacaatttctagaaatggtaccagcatctgca
gaagatttcaaaatagagattaagtctgatagagtactgttttctgggtacaccaaacaa
atcataaaagacagagactatttgaagcaaccaatggcagtaacagtcacaataagtctt
gaggaattgactgacaccaatcttcttctgttgaatccaaatgataaaccaattagtaag
atgatcaattttggtatgcgtgatttcaaaaactttttgaatctagttagttttttcaat
tcttcaacttcgtattccgaacagcttgatgaggatttcatcactgttgccaacaatgat
tactttcatatgtttttcaggaatccaggtgatcctatcttgtttgacttgcaaaacaac
caacacatggaggtacaatacatccagatcacctcagaagataaaaccgagatgaatgcc
aaggaaattaacgctgatacattaaagaaggatttactaatagaaggctccgtgccacag
aaggtggacaacgactcggtggaccaatctaggacaccaagcttgataaaacctattgga
agtactacatttggaaagccgacaattgctagaattcccactacttcagagagcggtata
tcccagaatgatccatcacaatcatatgctgtaggtataacctacgaacaagagtcagag
gaaagacagatccccgcaggagtaaccaagacgggtgacgaaacagattacagtgatgaa
acagaggaggacgaagatgaagggccaccaagaaaaagaatgctaatatcagatgaatta
ggaccgacacagttgacaaataaagcaaagtccatcttttaa

DBGET integrated database retrieval system